DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11436 and ttc17

Sequence 1:NP_572169.1 Gene:CG11436 FlyBaseID:FBgn0029713 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_012817550.1 Gene:ttc17 XenbaseID:XB-GENE-989867 Length:1190 Species:Xenopus tropicalis

Alignment Length:482 Identity:111/483 (23%)
Similarity:206/483 (43%) Gaps:88/483 (18%)


  Fly    11 LLGLFHLI------QACNHWVLREE-QIVPKLDSPFHMREPHNLAAFLKQIRYSEYVERSYLDLL 68
            ||||..|:      ||..|||:.|: :|..::|||.:::.||:|...::|.....|::.....|:
 Frog    26 LLGLLSLLSALPHSQATTHWVVTEDGKIQQQVDSPMNLKHPHDLVILMRQETTVGYLKELEKHLV 90

  Fly    69 RKREQIVEH----LRFSMRFGEDLAEQAKCA-----MDYY-----MLEKRMSYLKITPEQLKRIN 119
            .::..|.|:    .....|..:|..:..|..     :|.|     .||.:    .|:||      
 Frog    91 AQKIHIEENEDRDTGLEQRHYKDDPDCIKAKVPLGDLDLYDGTFISLESK----NISPE------ 145

  Fly   120 LPDQRQLHIQKSASSMG---MEPICSDYHRLSVGPATYDHLESFRPEV-LAAAFLEREH------ 174
              |...||     |::.   |:|.|:....|......:.||...:..: |:|..|.:|.      
 Frog   146 --DYADLH-----SALPPDLMQPDCTKIIELPFSIHAFHHLRGIQERLNLSAPLLPKEDPIFSSL 203

  Fly   175 DTNVGMATVELTRRFAVDGLQHHPASWKFHTLSSYYWRMRGNAREALPCARLAALLAPPIFKDIP 239
            ...:|....|:..|.. :||..:..||..:.::|:|||::....:.:.||..|...:....|||.
 Frog   204 HRRLGRTIDEMGHRIH-EGLLKNTTSWVLYNMASFYWRIKNEPYQVVECAMRALHFSSRQNKDIA 267

  Fly   240 LLSLGTILFRMGRLADADLILTAAVEHAPNVAENHVVLASALAMKHDFNRSLQHFDEAERLDPST 304
            |:::..||.|....|||.:::.||::.:.:...:|..|.:..||..::|.|:..:|.|.::.|. 
 Frog   268 LVNMANILHRAHFSADAAILVHAALDVSSDFLTSHYTLGNIYAMLGEYNHSVLCYDRALQVKPG- 331

  Fly   305 LPRTQQVRNFISCLENLTKKTSKMYSYVKYMQNEVKEFKKL------------KHHISQN----- 352
            .....:.::.:.|.:.|.:|....:..::...||:||::|.            ||.:.|.     
 Frog   332 FDHAIKRKHAVLCQQRLEQKLEAQHRSLQRTLNELKEYQKQHDHYLRQQEILEKHKLIQEEQILR 396

  Fly   353 ---HERLIQQQLPLGARRLLGLDAKTNNDDLHRRGQYCSTRTPNGSDEPVLF--CDFYSDMQMRL 412
               ||..:.::..||..::    .:.||   |:...:|..      |.||.:  .|.:.:::..|
 Frog   397 NIIHETQMAKEAQLGNHQI----CRINN---HKHSLHCPW------DLPVRYHRGDIFENVEQVL 448

  Fly   413 ESKDVDIDVL---ERDLKANTDAVIRQ 436
            ..:|:....:   ..|:.||...::.|
 Frog   449 FGEDMPYAHMTSGNHDVPANQSILLDQ 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11436NP_572169.1 TPR_11 240..302 CDD:290150 17/62 (27%)
TPR repeat 240..265 CDD:276809 9/25 (36%)
TPR repeat 270..300 CDD:276809 8/30 (27%)
ttc17XP_012817550.1 TPR repeat 267..293 CDD:276809 9/26 (35%)
TPR repeat 298..328 CDD:276809 8/30 (27%)
TPR_1 301..332 CDD:278916 9/32 (28%)
TPR repeat 333..360 CDD:276809 3/27 (11%)
GBP_C <345..414 CDD:303769 14/69 (20%)
coiled coil 383..394 CDD:293879 3/11 (27%)
coiled coil 403..414 CDD:293879 2/11 (18%)
TPR_12 622..686 CDD:290160
TPR repeat 623..649 CDD:276809
TPR repeat 656..686 CDD:276809
TPR_11 660..722 CDD:290150
TPR repeat 691..719 CDD:276809
TPR repeat 1065..1092 CDD:276809
TPR repeat 1097..1129 CDD:276809
TPR_11 1103..1165 CDD:290150
TPR repeat 1134..1162 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336044520
eggNOG 1 0.900 E1_KOG4507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005861
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.