DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usf and usf1

Sequence 1:NP_572167.3 Gene:Usf FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_956590.1 Gene:usf1 ZFINID:ZDB-GENE-040426-1072 Length:309 Species:Danio rerio

Alignment Length:355 Identity:92/356 (26%)
Similarity:130/356 (37%) Gaps:110/356 (31%)


  Fly    66 QQSLILTSDTGNPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDLDIHSLLPSNLQLPNNL 130
            ::..:.|::..:.:...|.|..|        |.|....|..|.| |....:..|.|         
Zfish    18 EEGAVATAEDPSAITTIQSASTF--------STDQPIKYLFKTE-GAGGQVGELYP--------- 64

  Fly   131 QLPTGCEIYLVKET--GSLMGEPPTKAAIKLELDTLSEKPLLPSVTTS--SSTQSAVITAQTVNP 191
              |:|...|.|.:.  |.|..:|....|:              ||.|.  ::||.......:.:.
Zfish    65 --PSGQVTYRVIQVADGQLEAQPDGTTAV--------------SVVTGFPATTQPVTQAVFSQSE 113

  Fly   192 PIPGNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHAQAR----SQPESAGQ-----TPSSKL-- 245
            .:.|:...|..|....|.:....|:...|       .||.    :|...|||     :|...|  
Zfish   114 GLEGDGTETHYTYYPATISDATAGTMVTG-------VQASDALLTQSAPAGQLYVMMSPQEVLTG 171

  Fly   246 ----------EAYK--------KRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSE 292
                      :||.        .||:||||.|||||||||||||:||.:|.:.:|.         
Zfish   172 ANQRSIAPRTQAYNAKSEGPRTSRDEKRRAQHNEVERRRRDKINNWIVQLSKTIPD--------- 227

  Fly   293 ASTSPSTSGSTSTNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETD 357
                 .|..||.|                   ..||..||.|||:||:.::.....|.|.|...:
Zfish   228 -----CTIDSTKT-------------------GQSKGGILSKACDYIQELRQSNSRLGDELNSIE 268

  Fly   358 SLRASNQALREELDRLKRQQQL---QERFH 384
            .||..||.||:|::..|.:.|:   |.|.|
Zfish   269 RLRMDNQLLRQEVEDWKSKNQILRNQLRQH 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 33/88 (38%)
usf1NP_956590.1 HLH 199..254 CDD:278439 33/88 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5040
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000308
OrthoInspector 1 1.000 T598073
orthoMCL 1 0.900 OOG5_141118
Panther 1 1.100 O PTHR46117
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1708
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.