DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usf and SPAC3F10.12c

Sequence 1:NP_572167.3 Gene:Usf FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_593944.1 Gene:SPAC3F10.12c PomBaseID:SPAC3F10.12c Length:201 Species:Schizosaccharomyces pombe

Alignment Length:230 Identity:48/231 (21%)
Similarity:75/231 (32%) Gaps:101/231 (44%)


  Fly   191 PPI--PGNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHA----------------------QAR 231
            ||:  ||.:...|..|:     .::|...       :|||                      ...
pombe    12 PPLSGPGQVEQLTGFTN-----DIVYNDF-------YAHAVSYNPYPSEKIDFPKKNTAHKNSTT 64

  Fly   232 SQPESAGQTPSSK-----LEAYKKRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFS 291
            |...|:|.|...|     .|.||    .:|.:|.|||||||:.|:..|.:|..::|         
pombe    65 STVASSGNTTMEKPCVGSEEWYK----AKRLSHKEVERRRREAISEGIKELANIVP--------- 116

  Fly   292 EASTSPSTSGSTSTNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRET 356
                           |...:||:                ||.:..:||:|::    .:.:..||.
pombe   117 ---------------GCEKNKGS----------------ILQRTAQYIRSLK----EMEEMCREK 146

  Fly   357 DSLR------------ASNQALREELDRLKRQQQL 379
            .:|.            ..|..|:.|.:|..|..:|
pombe   147 SNLEKLVADHTIQELARENARLKSECERAWRSVEL 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 21/88 (24%)
SPAC3F10.12cNP_593944.1 HLH 87..141 CDD:238036 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000308
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1708
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.