DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usf and srebf2

Sequence 1:NP_572167.3 Gene:Usf FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:XP_012816036.1 Gene:srebf2 XenbaseID:XB-GENE-1011360 Length:1096 Species:Xenopus tropicalis

Alignment Length:401 Identity:85/402 (21%)
Similarity:136/402 (34%) Gaps:140/402 (35%)


  Fly    18 SNTNTSTSPSSVNISNANP--TAGPGLMT--------ITNHHTADLSE--ALVHSSFAN--GQQS 68
            :|...:..|.:.|.:...|  |:.|...|        :|...||.|.:  .::.||...  .||:
 Frog    52 NNAMETALPKAYNQAPQQPYTTSTPQPQTLPVKAPSQVTPQRTAPLLQPRPVIQSSPQPQLQQQT 116

  Fly    69 LILTSDTG---------NPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDLDIHSLLPSNL 124
            ::||.:..         .||:....|..|                .:.|.|     :.||:.:..
 Frog   117 VMLTPNFSTAPQTRIIQQPLIYQNAATSF----------------QVLQPP-----VQSLMTTQQ 160

  Fly   125 QLPNNLQLPTGCEIYLVKETGSLMGEPPTKAAIKLELDTLSEKPLLPSVTTS------------S 177
            ..|..:|          ::..::..:.....|....:.||:....:.:||..            .
 Frog   161 MQPVTIQ----------QQVQTVQAQRVLTQAANGTIQTLTPATTVQTVTPQVQQVPVLVQPQII 215

  Fly   178 STQSAVITAQTV----------NPPIPGNINTTTSTTSTTTTTSV--LYGSHGNGHGHGHAHAQA 230
            .|:|.|:||...          ||.|     ||.:|...||...|  |.||:|         ...
 Frog   216 KTESLVLTAVKADGSPVMTTMQNPAI-----TTLATPIQTTALQVPTLMGSNG---------TIL 266

  Fly   231 RSQPESAG-------QTPSSKLEAYKKRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSS 288
            .:.|...|       |.|.|..:....::.:||.|||.:|:|.|..||..|.:||:::       
 Frog   267 TTMPVMMGQEKMPIKQVPGSLKQPEVPKEGERRTTHNIIEKRYRSSINDKIIELKDLV------- 324

  Fly   289 SFSEASTSPSTSGSTSTNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCL 353
                          ..|:...|                 ||.:|.||.:|||.:|.....||   
 Frog   325 --------------MGTDAKMH-----------------KSGVLKKAIDYIKYLQQVNQKLR--- 355

  Fly   354 RETDSLRASNQ 364
            :|..:|:.:||
 Frog   356 QENMALKLANQ 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 23/88 (26%)
srebf2XP_012816036.1 HLH 298..348 CDD:278439 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1708
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.