DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and Tmed9

DIOPT Version :10

Sequence 1:NP_572165.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_080487.2 Gene:Tmed9 / 67511 MGIID:1914761 Length:235 Species:Mus musculus


Alignment Length:233 Identity:54/233 - (23%)
Similarity:102/233 - (43%) Gaps:47/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVGS-------LLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGF--------- 58
            ||:|.       ||.|.....|....:....::||.|.:...|       ::.|.:         
Mouse    16 LLLGRGMRAFLLLLWLAARGSALYFHIGETEKKCFIEEIPDET-------MVIGNYRTQLYDKQR 73

  Fly    59 ---------LDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFS- 113
                     |.:.:::..|::.|:...:..|.|::||.:...|.:.:|.:    |.:.|..:|: 
Mouse    74 EEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLH----SNSTKFSLFAG 134

  Fly   114 --------IDVGDAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNE 170
                    |.||:..........::::...:|.  :|:|...:..::.||.|...|::..|..:|
Mouse   135 GMLRVHLDIQVGEHANDYAEIAAKDKLSELQLR--VRQLVEQVEQIQKEQNYQRWREERFRQTSE 197

  Fly   171 NTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVKRVV 208
            :||.||:.||..:.|:||.:.|.|:.:||.|||.|::|
Mouse   198 STNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV 235

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_572165.1 EMP24_GP25L 24..203 CDD:426051 44/205 (21%)
Tmed9NP_080487.2 EMP24_GP25L 37..230 CDD:426051 44/205 (21%)
Required for interaction with STX17. /evidence=ECO:0000250 121..160 7/42 (17%)
COPI vesicle coat-binding. /evidence=ECO:0000255 228..235 4/6 (67%)