DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and Ticam2

DIOPT Version :10

Sequence 1:NP_572165.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001102360.1 Gene:Ticam2 / 364867 RGDID:1308258 Length:232 Species:Rattus norvegicus


Alignment Length:134 Identity:29/134 - (21%)
Similarity:48/134 - (35%) Gaps:54/134 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAP---QRAPGAPGEEEVGHT 135
            |||:.:                   |:|.:| :|..|:.|..| :.|   |..|.|.||   ||.
  Rat    28 HESDSK-------------------NSENAS-SPAFVVHSNGV-EQPIGEQDRPEAKGE---GHE 68

  Fly   136 KLEDMIRELSGTLTSVKHEQEY-----MHVRDKIHRSVNENTNSRVVLWSTF---EALVLVLMTV 192
            :               :.|:|:     :|..|    ..||....:.:|.:.|   ..:|...|..
  Rat    69 E---------------QAEEEFLKFVILHAED----DTNEALRVQNLLQNDFGIRPGIVFAEMPC 114

  Fly   193 GQVY 196
            |:::
  Rat   115 GRLH 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_572165.1 EMP24_GP25L 24..203 CDD:426051 29/134 (22%)
Ticam2NP_001102360.1 TIR_2 78..197 CDD:463954 9/45 (20%)

Return to query results.
Submit another query.