DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHOp24 and CG31787

Sequence 1:NP_001284862.1 Gene:CHOp24 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_724105.1 Gene:CG31787 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster

Alignment Length:222 Identity:52/223 (23%)
Similarity:100/223 (45%) Gaps:30/223 (13%)


  Fly     5 LAKVLLLVGSLLIL-CRTSHA------FIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGF--LD 60
            :|:|:.|:..||:| .:.|:|      ..|..:|..:|||::.:.......:.::||.||.  ..
  Fly     4 IARVIWLLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETH 68

  Fly    61 VDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPG 125
            ::..:..|...::....|...||::..|...|:|..||:|..|:...|:|.|:::|      ||.
  Fly    69 INFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEV------APA 127

  Fly   126 APGEEE---------------VGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSR 175
            ...|.|               |.:|.::..:.::...|...:..|:::...:...|:|.|:|.|.
  Fly   128 DREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSM 192

  Fly   176 VVLWSTFEALVLVLMTVGQVYYLKRFF 202
            |..||..:.|.::.:...||..::..|
  Fly   193 VNKWSWAQFLSMIFVGFLQVLMVRSIF 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 45/203 (22%)
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 44/197 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120899096
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000199
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22811
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.