DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and TMED10

DIOPT Version :10

Sequence 1:NP_572165.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_006818.3 Gene:TMED10 / 10972 HGNCID:16998 Length:219 Species:Homo sapiens


Alignment Length:210 Identity:55/210 - (26%)
Similarity:100/210 - (47%) Gaps:20/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLVGSLLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEVID----GGFLDVDIKISGP 68
            :|.|:|..|:|..:.|     :..::.:|..|.:.........:|:.|    .|.|...:||:..
Human    20 LLFLLGPRLVLAISFH-----LPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDS 79

  Fly    69 DNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTP-KLVMFSIDVGDAPQRAPGAPGEEEV 132
            ..|:::..|..:.||:.|.......:.|||.::.:...| :||:..:..|      ..|...||:
Human    80 AGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHG------VEAKNYEEI 138

  Fly   133 GHTK----LEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVG 193
            ...:    ||..:|.|.....|:.::..||..|::..|..||:||:||:.:|.|....|:.:...
Human   139 AKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATW 203

  Fly   194 QVYYLKRFFEVKRVV 208
            ||:||:|||:.|:::
Human   204 QVFYLRRFFKAKKLI 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_572165.1 EMP24_GP25L 24..203 CDD:426051 47/187 (25%)
TMED10NP_006818.3 Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 1..142 29/132 (22%)
EMP24_GP25L 31..213 CDD:426051 48/192 (25%)
Required for TMED10 and TMED2 cis-Golgi network localization 147..178 9/30 (30%)
Interaction with COPG1 204..219 8/15 (53%)
Interaction with ARF1 and IL1B. /evidence=ECO:0000269|PubMed:11726511, ECO:0000269|PubMed:32272059 207..219 6/12 (50%)
COPI vesicle coat-binding 211..219 3/8 (38%)