DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NO66 and Riox2

Sequence 1:NP_572160.1 Gene:NO66 FlyBaseID:FBgn0266570 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_080186.3 Gene:Riox2 MGIID:1914264 Length:465 Species:Mus musculus

Alignment Length:518 Identity:139/519 (27%)
Similarity:227/519 (44%) Gaps:113/519 (22%)


  Fly   183 KAEPTEEGNNNND---------EKETETIETHKADSVEEGRRVLQWILFPVQTKVFFKDFWEHTA 238
            |.:||  |:.|.:         |:..||:.....||...   ..:.::.|::.:.|||:|||...
Mouse     4 KVQPT--GDENEEASVPCKRVKEELPETLSVLNFDSPSS---FFESLISPIKVETFFKEFWEQKP 63

  Fly   239 CLVQRSNP---KYFQSMISFKMLDEILIRHHLDFTVNVDVTTYKNGKRETLNPEGRA-LPPAVWG 299
            .|:||.:|   ||:||:.|...|.. |.:..:.:..:|:|....:||::.||.:||| .......
Mouse    64 LLIQRDDPVLAKYYQSLFSLSDLKR-LCKKGVYYGRDVNVCRSISGKKKVLNKDGRAHFLQLRKD 127

  Fly   300 FYSDGCSIRLLNPSTYLIRLRQVCTVLQEFFHCKVGANLYLTPPNSQGFAPHYDDIEAFVIQVEG 364
            |.....:|:...|..|...|.::...|:.:|...||:|:|:||..|||..|||||:|.|::|:||
Mouse   128 FDQKRATIQFHQPQRYKDELWRIQEKLECYFGSLVGSNVYMTPAGSQGLPPHYDDVEVFILQLEG 192

  Fly   365 RKRWLLYEPPKKADQLARISSGNYDQEQLGKPIIDEVLSAGDVLYFPRGAVHQAITEE-QQHSLH 428
            .|.|.||.|.........:.|    ::::|.|..|.:|..||:||||||.:|||.|.. ..:|:|
Mouse   193 TKHWRLYSPTVPLAHEYSVES----EDRIGTPTHDFLLKPGDLLYFPRGTIHQAETPSGLAYSIH 253

  Fly   429 ITLSVYQQQAYAN-LLETLMPMVLKKAVDRSVALRRGLPLHTFQVLGNAYKGNDCGSRKQLVE-- 490
            :|:|.||..::.: ||:::...|...|.: .||||.|:|                  |:.|:.  
Mouse   254 LTISTYQNNSWGDCLLDSISGFVFDIAKE-DVALRSGMP------------------RRMLLNVE 299

  Fly   491 ---NVQKLVTNYLMPSEDDIDEAVD----QMAKKFQHEALPPIVLPSEEVRTVHGARSDADEQGN 548
               :|.:.::.:|....|.::...:    .|.|.|....|||.         ..|..::..:.| 
Mouse   300 TPADVTRKLSGFLRTLADQLEGREELLSSDMKKDFVKHRLPPF---------FEGNGTETMDPG- 354

  Fly   549 CVCDYKFNKKTSVRLLRANILRL-----VTESDGS------------VRIYHHVDNGLDYCKYEP 596
                     |...||  .||:||     :..:.|.            |.|||.:.|...      
Mouse   355 ---------KQLPRL--DNIIRLQFKDHIVLTVGPDKNPFDEAQQKVVYIYHSLKNVRQ------ 402

  Fly   597 YFMEILPEEAKAVELLISAYPFY-------------LTIDQLPLESSARKIEVATALWEHGLL 646
              |.::.||.:: |:....:|..             :.:..|.|::...|..:|.:||...|:
Mouse   403 --MHMIGEEEES-EIFGLRFPLSHVDALKQIWCGSPIRVKDLKLDTDEEKENLALSLWSESLI 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NO66NP_572160.1 cupin_like 229..534 CDD:304367 101/320 (32%)
Riox2NP_080186.3 Cupin_4 51..363 CDD:285279 107/357 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135492863
eggNOG 1 0.900 E1_KOG3706
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D256684at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130046
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2682
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.