DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NO66 and jmjc-1

Sequence 1:NP_572160.1 Gene:NO66 FlyBaseID:FBgn0266570 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_001021644.1 Gene:jmjc-1 WormBaseID:WBGene00020902 Length:748 Species:Caenorhabditis elegans

Alignment Length:522 Identity:165/523 (32%)
Similarity:276/523 (53%) Gaps:58/523 (11%)


  Fly   169 KKDPAAVNSLVKIIKAEPTEEGNNNNDEKETETIETHK-----------------ADSVEEGRRV 216
            ::|.:...|:|..:.|:..:||.....::|...|...|                 .|||....|.
 Worm   243 EEDVSDEESVVSEMDADSDDEGFIAGKDREAHVISKDKFTRNAPAVDFDKFPFTDEDSVVTSSRA 307

  Fly   217 LQWILFPVQTKVFFKDFWEHTACLVQRSNPKYFQSMISFKMLDEILIRHHLDFTVNVDVTTYKNG 281
            ..:::.|...:.||..|::....:|:|..|.||.::.|...|.|:|.::||::..|:::..||||
 Worm   308 FGFMISPCDVQTFFDKFYQSNVLVVRRKQPTYFGNLFSTARLGELLEKNHLEYGRNINIAQYKNG 372

  Fly   282 KRETLNPEGRALPPAVWGFYSDGCSIRLLNPSTYLIRLRQVCTVLQEFFHCKVGANLYLTPPNSQ 346
            .|.|||.:|||.|..|.....:.||::|:||.||..|:..:|.|:||.|.|.||||.||||..|.
 Worm   373 VRTTLNGQGRAYPQIVKQHLHNMCSVQLVNPQTYDDRIWYLCEVIQEQFGCFVGANTYLTPAGSS 437

  Fly   347 GFAPHYDDIEAFVIQVEGRKRWLLYEPPKKADQLARISSGNYDQEQL--GKPIIDEVLSAGDVLY 409
            |||||:|:|:||::||||||.|.::.|....::|...||.|:.::.:  .:|:.:..:..||::|
 Worm   438 GFAPHWDEIDAFLLQVEGRKYWRVWAPESAEEELPLESSDNFTEDDMKGREPVFEGWIEKGDMIY 502

  Fly   410 FPRGAVHQAITEEQQHSLHITLSVYQQQAYANLLETLMPMVLKKAVDRSVALRRGLPLHTFQ--- 471
            .|||.:|||.|:.:.||||:|:|..:|.::|||:|.::|..:....|....||||||...|.   
 Worm   503 IPRGYIHQARTDSKVHSLHVTVSTGRQWSFANLMEKVVPEAIGVLTDTRHKLRRGLPTGLFDMGG 567

  Fly   472 VLGNAYKGNDCGSRKQLVENVQKLVTNYL-----MPSEDDIDEAVDQMAKKFQHEALPPIVLPSE 531
            |:...|...|     ..||..:.:|..::     :.::..::.:||.:||:|..:||||.:...|
 Worm   568 VIDLDYSQED-----HFVEKFKMVVDRHMSMLRNLVADQLLESSVDSLAKEFMKQALPPRLTEQE 627

  Fly   532 EVRTVHGARSDADEQGNCVCDYKFNKKTSVRLLRANILRLVTESDGSVRIYHHVDNGLDYCKYEP 596
            :..:|.|  |..:..|:.:.|  |..:|.|||:|.:..||:.||:.:..|.|.::|.        
 Worm   628 KKLSVLG--SSTNLLGDDLVD--FTARTKVRLIRRHTQRLLMESEDACFISHRINNS-------- 680

  Fly   597 YFMEILPEE--------AKAVELLISAYPFYLTIDQL----PLESSARKIEVAT--ALWEHGLLM 647
            ...|..||:        ..|..:|.::||.:.|:.::    ..::.:||..:|.  .|::.|:|:
 Worm   681 RLFEGRPEQIVEYPISGIDAYRVLSNSYPEWRTLYEIFSLRETKTKSRKENLAAIQLLFQIGVLL 745

  Fly   648 TE 649
            .:
 Worm   746 VK 747

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NO66NP_572160.1 cupin_like 229..534 CDD:304367 119/315 (38%)
jmjc-1NP_001021644.1 Cupin_4 317..662 CDD:285279 130/354 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135484482
eggNOG 1 0.900 E1_KOG3706
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 264 1.000 Inparanoid score I1864
Isobase 1 0.950 0 Normalized mean entropy S5745
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006313
OrthoInspector 1 1.000 T475450
orthoMCL 1 0.900 OOG5_130046
Panther 1 1.100 LDO PTHR13096
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2682
TreeFam 1 0.960
1211.730

Return to query results.
Submit another query.