DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12692 and CG9970

Sequence 1:NP_001284857.1 Gene:CG12692 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_647754.1 Gene:CG9970 FlyBaseID:FBgn0035380 Length:484 Species:Drosophila melanogaster

Alignment Length:350 Identity:107/350 (31%)
Similarity:162/350 (46%) Gaps:25/350 (7%)


  Fly    60 GAVTRVCIGTSTFWCTSSLLQFHSNYFDRNICPVNCFR-EGTDLIAVGFRAAYTWMRLQEPLDPF 123
            ||:..|.||.:.|.|...||:..|.:|......:..|: :..::.:.||:..|.|||..: |..|
  Fly   146 GALALVQIGENKFKCIPCLLRCFSVWFGIRDWRITRFKFKEREVPSGGFKVVYEWMRTNK-LPEF 209

  Fly   124 MQPDKLMTLLHTAVQLEMPALKALCYEQLCTDRFREETAFQVYLRALKYPQLEELRKLMLQRIGA 188
               |:|:..|..|..|::..|:...::.|..:..||:.||.|||.|.:.|.|..|.:.||.|:..
  Fly   210 ---DELVPALQVACHLKVTLLEKEIWQILSDESVREKVAFLVYLGARRMPALGALCEAMLFRLRK 271

  Fly   189 AFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWL-NCQSKCIDQATPLLMDCLRL 252
            .|||::|...|.|:.::.:..:|:|||:||||||||..|:|||| :.:.:...:....||.|:|.
  Fly   272 YFLALVGSPHFVRLKVDVLEMLLRQDSIGVNSEMEVFFAVIRWLGHSRGRKRREHFQRLMKCVRF 336

  Fly   253 TLLPLPILKRFWRCAMAPPVPD----EPFMNAVRGNIHIRERISCAITVVQMHHLHTSRREFLDF 313
            ..:|:..|.........|...|    ||.|.|...:..:.|.:..||..:.:........|||..
  Fly   337 HHMPMTFLFSLRESFNHPEKFDLFSKEPGMLAFNTDPEMMELLEHAIYFISVRTQCDDINEFLST 401

  Fly   314 CRSKGLLVDMPREWIYDEQCHYHLPRPGGPYSHLICVHVISNY--AIQRAQRLMESSKRWPRRVN 376
            |.|..:.|.:||.|:|...|.:||.....||.|........:|  :||         |.|..:  
  Fly   402 CESHHIEVVLPRWWVYHVNCPFHLRTIDFPYQHRFTATDFGDYIDSIQ---------KVWSGK-- 455

  Fly   377 TYMPPSDDLQTINELPEDKDEEAQV 401
              .||.|....:.:|..|.....||
  Fly   456 --GPPDDGKDLVIDLALDPLRGGQV 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12692NP_001284857.1 BACK 162..265 CDD:285009 41/104 (39%)
CG9970NP_647754.1 BACK 254..346 CDD:197943 35/92 (38%)
DUF4734 373..450 CDD:292506 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5152293
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22667
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.