DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12692 and kel-3

Sequence 1:NP_001284857.1 Gene:CG12692 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_499784.2 Gene:kel-3 WormBaseID:WBGene00002185 Length:591 Species:Caenorhabditis elegans

Alignment Length:185 Identity:51/186 (27%)
Similarity:81/186 (44%) Gaps:44/186 (24%)


  Fly   129 LMTLLHTAVQLEMPALKALCYEQLCTDRFREETAFQVYLRALKYPQLEELRKLMLQRIGAAFLAV 193
            |:|.||.:..|   :::..| :.:|.:                    |::.::....|...|:||
 Worm   146 LLTRLHPSNAL---SIREFC-KMMCVE--------------------EKITEMTDDYIQKHFMAV 186

  Fly   194 LGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWLNCQSKCIDQATPLLMDCLRLTLLPLP 258
            ...:||:|:.|||.|.:|:.|.|.|:||.:|.||.:.||||.....:||..:| .|:||.||...
 Worm   187 SKDEDFKRLSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVIRHEQAAKIL-PCVRLPLLSPT 250

  Fly   259 ILKRFWRCAMAPPVPDEPFMNAVRGNIHIRERISC--AITVVQMHHLHTSRREFL 311
            .|.                 :.|..|..|::.|.|  .|...:.:||...||..:
 Worm   251 YLS-----------------SIVASNPIIKKDIPCRDLIDEAKDYHLLPDRRSLI 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12692NP_001284857.1 BACK 162..265 CDD:285009 34/103 (33%)
kel-3NP_499784.2 BTB 41..147 CDD:279045 1/1 (100%)
PHA03098 51..568 CDD:222983 51/186 (27%)
BACK 155..257 CDD:285009 38/144 (26%)
Kelch 304..350 CDD:128874
KELCH repeat 341..384 CDD:276965
Kelch 352..396 CDD:128874
KELCH repeat 388..431 CDD:276965
Kelch 399..445 CDD:128874
KELCH repeat 435..479 CDD:276965
Kelch 446..492 CDD:128874
KELCH repeat 482..527 CDD:276965
Kelch 493..539 CDD:128874
KELCH repeat 529..572 CDD:276965
Kelch 541..584 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.