DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Glos and CG32783

Sequence 1:NP_001284848.1 Gene:Glos FlyBaseID:FBgn0029686 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_726901.2 Gene:CG32783 FlyBaseID:FBgn0052783 Length:911 Species:Drosophila melanogaster

Alignment Length:911 Identity:878/912 (96%)
Similarity:895/912 (98%) Gaps:0/912 (0%)


  Fly     1 MITAKKHPLDNCQLFVQLKKLFHDYNEKVQRLKDMIYWSGNDEHIAKICDQVTDLLVEHDLIIQP 65
            ||||:|||||||||||||||:|||.||:.:.||||||||||||||.||||||||||.||||||||
  Fly     1 MITAEKHPLDNCQLFVQLKKIFHDNNEQAKCLKDMIYWSGNDEHIEKICDQVTDLLEEHDLIIQP 65

  Fly    66 PDTMDPCAMNHLRGLLVYLVLNTAHDDIQCESQWSANVMHLCNQLPPIPLFLTIAIAVNCCLMEP 130
            ||||||.|||.|||||||||||||||...|:||||||||||||||||||||||||||||||||||
  Fly    66 PDTMDPFAMNQLRGLLVYLVLNTAHDYFLCKSQWSANVMHLCNQLPPIPLFLTIAIAVNCCLMEP 130

  Fly   131 LEEFLACGPRWLTIQYFEAFNEALSVINSDCVETLPLLSAALRAAGRAIVNCNLPAENKQLLRQI 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 LEEFLACGPRWLTIQYFEAFNEALSVINSDCVETLPLLSAALRAAGRAIVNCNLPAENKQLLRQI 195

  Fly   196 ACMEHRHILDSKQRLHTLPRPSTRKIYLAKAMDHLIEVLLYTLNDPLKREKPNCFAVYSQITEDI 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 ACMEHRHILDSKQRLHTLPRPSTRKIYLAKAMDHLIEVLLYTLNDPLKREKPNCFAVYSQITEDI 260

  Fly   261 SDSNSSDPMPDLRHFAQILLDVLQRIFQLVSVDTYMYWHEMKSKSALYNCQELICRQTAELLKVL 325
            |||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||
  Fly   261 SDSNSSDPMPDLRHFAQILLDVLRRIFQLVSVDTYMYWHEMKSKSALYNCQELICRQTAELLKVL 325

  Fly   326 QSDKLLGEHPVCKQMQSFADAAKTLEQRVAEMRIGELLAFIDSGMATNEELLAGLDNLFSRFIAF 390
            |||.:||||||||||||||||||||||||||||:||||.|:||||||:|||||||||||||||||
  Fly   326 QSDNMLGEHPVCKQMQSFADAAKTLEQRVAEMRMGELLVFLDSGMATDEELLAGLDNLFSRFIAF 390

  Fly   391 GSDECLETMANHLIMLTKKHAQIILSFLGQVVESEMVVEDEGISVTEVNQGDDEDETSSNDDYEE 455
            |:|||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   391 GNDECVETMANHLIMLTKKHAQIILSFLGQVVESEMVVEDEGISVTEVNQGDDEDETSSNDDYEE 455

  Fly   456 LLSLVLRPLFMQLNVEDKMEVLLLRDEQNVTQGFNFKAPDHRERRIRFFNQLDYNKRFPITEFLV 520
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||
  Fly   456 LLSLVLRPLFMQLNVEDKMEVLLLRDEQNVTQGFNFKAPDHRERRIRFFNQLDYNKRFPITKFLV 520

  Fly   521 LCFENARQTWIDFSHLGVTHTRFSKLFWHIAQSCPKHAAFHISACADNILVNEQLLQKPYALQFT 585
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   521 LCFENARQTWIDFSHLGVTHTRFSKLFWHIAQSCPKHAAFHISACADNILVNEQLLQKPYALQFT 585

  Fly   586 LYLYGHRQILNGLYTSARQLCVSLKDGRCPYGEDELRQAQNRFLDACAYGLAKFIEPMNLPSLQL 650
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   586 LYLYGHRQILNGLYTSARQLCVSLKDGRCPYGEDELRQAQNRFLDACAYGLAKFIEPMNLPSLQL 650

  Fly   651 ILKLLKQISLGESNLITRGTAELNALEKEHPKLENGDDAPAVKVAKHYTYLHASLPEWRLKHWKL 715
            |||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||||||
  Fly   651 ILKLLKQISLGESNLITRGTAELNALEKEHPKLENGDDAPAVKVAKHYTYLNASLPEWRLKHWKL 715

  Fly   716 ISHVMKTIDALRWDLATFEDFRVDNLELAVWYWQDGLSHLTFLGTEFRQRILNQVSKLKHKDFWI 780
            ||||||||||||||||||||||||||||||||||||||||||||||.||||||||:.||||.||:
  Fly   716 ISHVMKTIDALRWDLATFEDFRVDNLELAVWYWQDGLSHLTFLGTECRQRILNQVNSLKHKGFWL 780

  Fly   781 IYLKEDTLKDTRSFLKLLTQSSAQEANDLFNKLLKKRADCAVMGDLSDAVVKVNSESAFMAFRFL 845
            ||||||||||||||||||||||||||||||.||||||||||||||||||||||||||||||||||
  Fly   781 IYLKEDTLKDTRSFLKLLTQSSAQEANDLFKKLLKKRADCAVMGDLSDAVVKVNSESAFMAFRFL 845

  Fly   846 FREYLIAFRSHAKHNKTITKRQHWDHLMAVVAKAPFSIRNEIMELASKAFAVRFGINIQEQQAAK 910
            |||||||||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||
  Fly   846 FREYLIAFRSHAKHNKTITKRQHWDHLMAVVAKAPFSIRNEIMKLASKAFAVRFGINIQEQQAAK 910

  Fly   911 C 911
            |
  Fly   911 C 911



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134620317
eggNOG 1 0.900 E1_2E75N
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.