DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42541 and Rgk2

Sequence 1:NP_996345.3 Gene:CG42541 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:NP_001286577.1 Gene:Rgk2 FlyBaseID:FBgn0085419 Length:742 Species:Drosophila melanogaster

Alignment Length:852 Identity:238/853 (28%)
Similarity:331/853 (39%) Gaps:250/853 (29%)


  Fly   480 GGG----VHQQHQVMVAHQAHAHTQVSNQQPVLQVQLPTPGVHVVHRLLPTP---------PTHS 531
            |||    .|..|..:.|..|      ||       .||..|.        ||         ||.|
  Fly    14 GGGSYGHPHSSHHKVPARAA------SN-------PLPCKGA--------TPKLPRQYHGGPTSS 57

  Fly   532 -GKGAYHT-RETALQRVQQQ-----------SGYYNQGPS----TSASAYGYNQAMEQQQMQQQL 579
             ..|.|.| |...:.....|           |.||...||    .|||...........:.|.|.
  Fly    58 YNYGGYDTPRSPKITTTFAQDSCDDVSSSTPSSYYQTPPSGSIDDSASLLSGRTTARSPKSQCQF 122

  Fly   580 HYD---PHQELQFEQHQPHQSHQQQQLQHQQQHQLQHQQQHQQQQQYQQQQHQQQQHQQYADDTE 641
            .:|   |....:||.::|..                                        .||..
  Fly   123 VFDAVSPSHGRKFEYYEPIS----------------------------------------PDDGA 147

  Fly   642 LDYD---------------TEWELDEEPAPQIVPPLTTFNDFVNA-------------AQNPTGS 678
            |.||               |:..||  |.||:.   ||..|...|             ||.....
  Fly   148 LYYDPPSSPRRQGSKKLMRTKTPLD--PVPQLT---TTGVDESMAVAMAMGGAGGGGYAQGGPNK 207

  Fly   679 RQSLRAQ-KSPILNR---RRASSIAGNLLHSDYTYTRNSIGGAPIDSNDFQRISHSSSARDRMSL 739
            ||  |.: :.|::::   |..|:.||:          :|.||:      :..:...|...|...|
  Fly   208 RQ--RDEWELPVISKIEARNLSAAAGS----------SSAGGS------YYGLKRDSCVTDCTQL 254

  Fly   740 ---AGVLTFQQAISGAVSPQYGTVGSLNSQVPATGEAGKPGIVGSDGIGGGGGGLPGGSSHNLNL 801
               :|....|...|..|:  :.|.....::.....|||:|             .|.....|.:|:
  Fly   255 SMESGETGTQHTNSTMVT--HTTTSFSFTEPEMEQEAGQP-------------QLRRQRRHAINI 304

  Fly   802 TVGLGF--LGGSSTTLAAVAEVTSGPDGNGDSTDSPSPVSM-----IPSNQQKQQQQLLQLQLQQ 859
            |...|:  |..|.:||              |.|.|.|.||:     .....|..:.:|...:..:
  Fly   305 TSNPGYQVLHSSHSTL--------------DRTCSDSVVSLRYRKSTSDLTQDAEHELSGCKPNK 355

  Fly   860 EQQHLPTHLPMKR------------ERGVGESSGASTSGTAIAELASSVVLATQSGK-------- 904
            .:.|: .|.|.:|            .|...||..::.|..:|........||.||..        
  Fly   356 PKAHV-EHKPRRRGSSKGGLAYLASRRSSRESMKSACSNASIVSNDDVGPLAFQSSNRGRQRRTS 419

  Fly   905 -----PMTERQRLRTSSMPAESRRPRLAEMRRSAIHAGDPDMTYYRLRSFSITSHGICNLGDSLR 964
                 |:.:..|.|..|:|.....||.::           |:  ||||.|||:...:.|.|||:.
  Fly   420 NFLELPVPDHVRPRVCSLPERPYNPRASD-----------DL--YRLRHFSISKGNVVNCGDSII 471

  Fly   965 SRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDG-----------DPNVPA-YKIAMLGASG 1017
            ||||||..||.||.:..|.......:..||....:|.           ||..|| |::.|||.:|
  Fly   472 SRRSRSNTSVNSTNSRASERSPFEGSCCGAGYANVDSLPATPDDSENLDPPPPARYRVVMLGDAG 536

  Fly  1018 VGKTTLTYQFTTSDYICAYDLS--LDDDYGQKTVSVLVDNIETDLEIIDHPACEMSTEAFCATYN 1080
            ||||.|..||.||:|:..||.|  |||::|:||||||:|:.|:|:..||||:.|||.|...:||.
  Fly   537 VGKTALVNQFMTSEYMHTYDASLVLDDEFGEKTVSVLLDDEESDMVFIDHPSVEMSVENSLSTYE 601

  Fly  1081 IDLFVVVYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIA 1145
            ....|||:||:||::|..||.::.||.:......:..|||.||.||.|.|::|.|.|:.:|....
  Fly   602 PHGCVVVFSVVDRSSFRVAEEIINYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAASRD 666

  Fly  1146 CKFIETSSGLDHNVDELLVGIVAQVKLNPQRLRLLTELELQRLNLQSTIQKHRGMHLQTRRMVRQ 1210
            .||||||||:.||||||||||:.|::|..:|.:..|..:::      |.:.|..:||....:   
  Fly   667 AKFIETSSGIQHNVDELLVGILKQMRLKEKREKKATASKMK------TSRTHISLHLAKELL--- 722

  Fly  1211 MSVCQGD 1217
            ..:|..|
  Fly   723 QKICLSD 729

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 86/169 (51%)
small_GTPase 1008..1171 CDD:197466 85/165 (52%)
Rgk2NP_001286577.1 RGK 527..742 CDD:206715 94/213 (44%)
small_GTPase 527..694 CDD:197466 86/167 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D301527at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45775
RoundUp 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.