DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42541 and rem1

DIOPT Version :9

Sequence 1:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster
Sequence 2:XP_012810748.1 Gene:rem1 / 100124825 XenbaseID:XB-GENE-493530 Length:280 Species:Xenopus tropicalis


Alignment Length:257 Identity:79/257 - (30%)
Similarity:121/257 - (47%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   968 SRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFTTSDY 1032
            |::..|...:|:.:|||.              || .|....::.:||..||||::|...|.....
 Frog    37 SKAAGSAHCSGSLDSGVS--------------DG-RNEAHLRVVLLGDPGVGKSSLVAIFRREQD 86

  Fly  1033 ICAYDLSLDDDYGQKTVSVLVDNIETDLEIIDHPACEM--STEAFCATYNI-DLFVVVYSVIDRN 1094
            ..|.:..|.:.:   ..:::||..||.|.::|.....|  :.|:..:...: :.:::||||.||.
 Frog    87 REAAEQQLAEVF---DCTLMVDGKETTLLVMDTDERNMKKAIESSDSPMRLGNAYIIVYSVTDRA 148

  Fly  1095 TFAAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKFIETSSGLDHNV 1159
            :|.:|..:...|:......:...|||.|||||.|.|.|:.:.||..|....|||||||:.|.|||
 Frog   149 SFESASELRIQLRRTRQAENIPIILVGNKTDLVRSREVSVEEGRACAVVFDCKFIETSAVLQHNV 213

  Fly  1160 DELLVGIVAQVKL-------------NPQRLRLLTELE---LQRL---NLQSTIQKH-RGMH 1201
            .||..|:|.|::|             ..||...||:..   |.||   |.:|:::.| |..|
 Frog   214 QELFEGMVRQIRLRREGADTAEGFRMQSQRKESLTKRARRFLDRLVTRNSRSSLKVHSRSCH 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 58/182 (32%)
small_GTPase 1008..1171 CDD:197466 57/165 (35%)
rem1XP_012810748.1 RGK 62..280 CDD:206715 70/217 (32%)
small_GTPase 63..227 CDD:197466 57/166 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.