DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2930 and AT5G19640

DIOPT Version :10

Sequence 1:NP_001284845.1 Gene:CG2930 / 31341 FlyBaseID:FBgn0028491 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_001318602.1 Gene:AT5G19640 / 832084 AraportID:AT5G19640 Length:609 Species:Arabidopsis thaliana


Alignment Length:66 Identity:16/66 - (24%)
Similarity:29/66 - (43%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 LSLFIVPPVFFCTVNKLQINTIIAL-VGFSFTLVVFELLREF----VFGNIRVDPIQFVVYSIIP 366
            :..||:..:||...|...:.|::.| ....|..:..|.:..|    |.|:.::|.|:..:..|..
plant     8 IHFFILLFLFFIFTNSATVPTLLCLKCDKDFEKIKDEFIHLFDMKDVLGSSKLDFIKPAIKKIFT 72

  Fly   367 A 367
            |
plant    73 A 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2930NP_001284845.1 rad23 <15..>83 CDD:273167
2A1704 145..776 CDD:273343 16/66 (24%)
AT5G19640NP_001318602.1 MFS_NPF7 63..580 CDD:340977 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.