DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and XPR1

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_004727.2 Gene:XPR1 HGNCID:12827 Length:696 Species:Homo sapiens

Alignment Length:690 Identity:278/691 (40%)
Similarity:403/691 (58%) Gaps:67/691 (10%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            |||.:...:|:|.|||:||::|...|:::....:.|||...:.:..|:.|:..|||.|...|:.|
Human     1 MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKE 65

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQR---------AERSQKKLMTT 121
            |..:|.|:.|||.||:|:...|:.:|.:.......:...::|.||         .||.|.:  ..
Human    66 LAKINTFYSEKLAEAQRRFATLQNELQSSLDAQKESTGVTTLRQRRKPVFHLSHEERVQHR--NI 128

  Fly   122 RQLRYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQR 186
            :.|:.|::||||||:|:||||:||.||||||.||:||.:.:.....|.|.:|..|||...:.:.:
Human   129 KDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHVEVAPFYTCKKINQ 193

  Fly   187 MTIEVEDLYTTHLANGDRSLAMEKLRVPPLG--EPTPPSMVFRAGIALGMLIML---LVATAI-- 244
            :..|.|.:.|..|.:|||..||::|||||||  :|.|....||.|:..|:.|:|   ||..|:  
Human   194 LISETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVLAAVFK 258

  Fly   245 -----SYWKRAPLEDHTPGLMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRSHLQP 304
                 |.|.          |:|::||.|..:.|.|.:..|..||:||||||:||||::|||:|..
Human   259 LETDRSIWP----------LIRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRSNLSH 313

  Fly   305 ATFLEIACTFGILWALSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPARWWTIKL 369
            ....|||...||||.||:|...:.. |.|...||:||.|...||..|:.|.....:.:|:|.:||
Human   314 QHLFEIAGFLGILWCLSLLACFFAP-ISVIPTYVYPLALYGFMVFFLINPTKTFYYKSRFWLLKL 377

  Fly   370 VGRVITAPLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRYDR-----VNNCFEPDV-- 427
            :.||.|||.|.|||||||:.||:|||...::|..|.:.||::. |::|.     .||..|..:  
Human   378 LFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSLE-LKWDESKGLLPNNSEESGICH 441

  Fly   428 -----MVPITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTL-RRNSEGGYA 486
                 :..|..|:|.|.||.|||||:||: .::..:|:|||||||||.:|.|:.| ..:.|.|::
Human   442 KYTYGVRAIVQCIPAWLRFIQCLRRYRDT-KRAFPHLVNAGKYSTTFFMVTFAALYSTHKERGHS 505

  Fly   487 NTFSNPYTWL---FLSSCVVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYPQ-AFYYFVIVE 547
            :|....|.|:   .:|||     |..:||:..|:|||....||..|||:::|||| |:||..|:|
Human   506 DTMVFFYLWIVFYIISSC-----YTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYYCAIIE 565

  Fly   548 NLVLRLFWAVEFTILYHNLMTPYN---MRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDI 609
            :::||..|.::.:|....|: |::   :.|:.:.||:.|||:||:.|||||||.|||.|||.|||
Human   566 DVILRFAWTIQISITSTTLL-PHSGDIIATVFAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDI 629

  Fly   610 HLAALNPRQERMLESMMDESDGVSNRRKS-----NERIRL 644
            .:|.||...:.:||.|||:.|||.||:|:     |:.|.|
Human   630 SVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISL 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 65/170 (38%)
SPX_XPR1_like 2..158 CDD:269898 63/165 (38%)
EXS 260..597 CDD:281164 150/357 (42%)
XPR1NP_004727.2 SPX_XPR1_like 2..165 CDD:269898 63/165 (38%)
Important for inositol polyphosphate binding. {ECO:0000250|UniProtKB:P43585} 158..165 5/7 (71%)
EXS 268..617 CDD:308637 151/358 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.