DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and GDE1

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_015215.1 Gene:GDE1 SGDID:S000006031 Length:1223 Species:Saccharomyces cerevisiae

Alignment Length:208 Identity:47/209 (22%)
Similarity:79/209 (38%) Gaps:53/209 (25%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVE-----------------NAPSPLTSSDYEVQ 48
            ||||||:.:|...||..||:.|..||::||:...                 ..|:.:..|....|
Yeast     1 MKFGKTFANHRIPEWSSQYVGYKSLKKMIKEITRLQEDIYRAHNKNSYDEGRPPTKMRDSSNSAQ 65

  Fly    49 AY-----YKAFEETFLTECQSELTGVNNFF----------LEKLLEARRKHGHLKLQLLAYSREP 98
            .|     .:....:|......::..|:.|:          .|:||.: .:...:|..|:..:.:.
Yeast    66 NYLDSPKIQKLLASFFFAVDRDIEKVDTFYNSQYAEYKKRFERLLSS-NQFNEIKSTLVVDANKE 129

  Fly    99 GHTGSDSSLSQRAERSQKKLM--TTRQLRYAYAEFYLSLVLIQN--------------YQSLNET 147
            ....  .:|..:..|....|:  |::..|.:|.:.  .|:.||:              |..||:.
Yeast   130 DAVA--QTLLTKDTREMNMLLKGTSQASRLSYHKD--DLIEIQSILAELRKQFRNLKWYAELNKR 190

  Fly   148 GFRKICKKYDKNM 160
            .|.||.||.||.:
Yeast   191 AFGKILKKLDKKV 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 47/209 (22%)
SPX_XPR1_like 2..158 CDD:269898 45/204 (22%)
EXS 260..597 CDD:281164
GDE1NP_015215.1 COG5408 1..300 CDD:227695 47/209 (22%)
SPX_GDE1_like 2..204 CDD:269905 46/208 (22%)
ANK repeat 427..466 CDD:293786
Ank_2 432..535 CDD:289560
ANK repeat 468..501 CDD:293786
ANK 506..624 CDD:238125
ANK repeat 506..535 CDD:293786
Ank_2 508..603 CDD:289560
ANK repeat 540..569 CDD:293786
ANK repeat 572..603 CDD:293786
Ank_2 577..>642 CDD:289560
GDPD_YPL110cp_fungi 871..1219 CDD:176548
GDPD 877..1210 CDD:281062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.