DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and SYG1

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_012217.3 Gene:SYG1 SGDID:S000001309 Length:902 Species:Saccharomyces cerevisiae

Alignment Length:872 Identity:198/873 (23%)
Similarity:309/873 (35%) Gaps:295/873 (34%)


  Fly     1 MKFGKTYESHLT----IEWRQQYMRYGDLKELIKQGVENAPS-PLTSSDY-----EVQAY----- 50
            |||.    .|||    .|||.:|:.|...|:.:::..|...: ...||.|     .|..|     
Yeast     1 MKFA----DHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAFQ 61

  Fly    51 ----------------------YKAFEETFLTE------CQSELTGVNNFFLEKLLEARRKHGHL 87
                                  |.|.:..|:.:      ...:|:..|.|:|..|.|..:|...|
Yeast    62 QREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECDKKFEVL 126

  Fly    88 KLQLLAYSREPGH---------------------------------TGSDS-------------- 105
            :.||..||.:..:                                 ..|||              
Yeast   127 QSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSVMYGSMPCTKEA 191

  Fly   106 -----------------------------SLSQ--RAERSQK------------KLMTTRQLR-- 125
                                         ||.|  |.:.|.:            :.|||.|.|  
Yeast   192 KKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETFAFGASFLETMTTTQARNL 256

  Fly   126 --YAYAEFYLSLVLIQNYQSLNETGFRKICKKYDK--------------------------NMRS 162
              .|..|:||.|.|:::::.:|.|||||:.||:||                          |::.
Yeast   257 LSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTTFMSYARTHYTLFKHADANVQL 321

  Fly   163 VAAGRWFVENVLDAPFTDVRLLQR-------MTIEVEDLYTTHLANG--DRSLAMEKLRVPPLGE 218
            ||.....:.:....|.:::...||       :..::.:.:||.|.|.  ||.....||:...:..
Yeast   322 VAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQITEWFTTALTNSPKDRKHNTHKLKKLTIQY 386

  Fly   219 PTPPSMVFR----------AGIALGMLIMLLVAT--------AISYWKRAPLEDHTPGLMRLFRG 265
            .....||.|          .|:.:|:.:.|:..|        ..|:..:.        |..|:.|
Yeast   387 SISEQMVHRNNRSIVQMLVVGLGIGVSMTLITYTLYLGISSEETSFTHKI--------LFPLWGG 443

  Fly   266 PFTWVIFNFYMAANVAGWQQAGVNH--ILIFEIDPRSHLQ-----------P-----ATFLEIAC 312
            .:..::..|....|...|.:.|:|:  |::.||..::..|           |     .||..:.|
Yeast   444 WYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEIQSKNGTQFFNNDFATSKIPLKLYFLTFFIVPC 508

  Fly   313 ------TFGILWALSMLGFLYNDLIG-VSDPYVFPLGLILIMVGLLVVPLPIMNWP----ARWWT 366
                  :|. |..|:.|||||   || ||..::.|.|||           |.  |.    .|.|.
Yeast   509 AVCSMLSFA-LEKLTPLGFLY---IGIVSFLFLCPSGLI-----------PY--WDKVVHTRKWL 556

  Fly   367 IKLVGRVITAPLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRYDRVNN--C-FEPDVM 428
            :..:.|::.:....|.|.||::||.:.||...|.|   ...|:.:    |....|  | ......
Yeast   557 VVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIAD---IAMFFCV----YSHTPNNLCGSSHSRA 614

  Fly   429 VPITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYANTFSNPY 493
            :.:..|||.::||.||||||.|||. ...:|:||.||  |..:...:||........:.....| 
Yeast   615 MGVLSCLPSYWRFMQCLRRFADSGD-WFPHLLNAAKY--TLGIAYNATLCAYRLSDRSEQRRTP- 675

  Fly   494 TWLFLSSCVVATIYCYLWDVIRDFGLFR-------IMR-------------GERIFLRKQLVYPQ 538
               |:....:.:|....||::.|:....       ::|             |...|.||.:    
Yeast   676 ---FIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGSYSFSRKLV---- 733

  Fly   539 AFYYFVIVENLVLRLFWAVEFTILYHNLMTPYNMRTISSILEITRRFIWNYVRLENEHLFNCGNF 603
              |||.::.::::|..|.| :.|....:........|.::||:.|||:|...|:||||:.|...|
Yeast   734 --YYFAMIWDILIRFEWIV-YAIAPQTIQQSAVTSFILALLEVLRRFVWIIFRVENEHVANVHLF 795

  Fly   604 RATRDIHLAALNPRQERMLESMMDESD 630
            |.|.|   |.|.....::.:..||.||
Yeast   796 RVTGD---APLPYPIAQVGDDSMDSSD 819

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 63/324 (19%)
SPX_XPR1_like 2..158 CDD:269898 60/293 (20%)
EXS 260..597 CDD:281164 102/389 (26%)
SYG1NP_012217.3 COG5408 1..310 CDD:227695 62/313 (20%)
SPX_SYG1_like 2..291 CDD:269896 60/293 (20%)
SPX 2..98 CDD:271919 20/100 (20%)
COG5409 402..803 CDD:227696 114/450 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I800
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T634664
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.870

Return to query results.
Submit another query.