DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and ERD1

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_010702.4 Gene:ERD1 SGDID:S000002822 Length:362 Species:Saccharomyces cerevisiae

Alignment Length:383 Identity:77/384 (20%)
Similarity:137/384 (36%) Gaps:122/384 (32%)


  Fly   293 IFEIDPRSHLQPATFLEIACTFGILWALSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVP--- 354
            |..:.|     |..|:.:......:|...:..||:::| .||.       :||..|...:.|   
Yeast    16 ILNVPP-----PQRFIVLIILALWIWTWILKFFLHSNL-DVSQ-------VILTRVPHDIRPGYT 67

  Fly   355 LPIMNWPARWWTIKLVGRVITAPLHYVGFADFWMGDQMN----------------SLVSCIVDHY 403
            |..::..||.:.:|:...:|  |.|   ||..::.:.||                .|:.|:...:
Yeast    68 LQQLHRTARNFALKITRIII--PFH---FATVFLFEFMNIIEGPLKNIILIVYFLPLIQCVTIFW 127

  Fly   404 YTVRFYAISWLRY-----------------------DRVNNCFEPDVMVPITM------------ 433
            :.::...|  ::|                       |.:.:..:|  ::..|:            
Yeast   128 FLLKECQI--IKYCTRRCLLIESSPRSLRNTYILISDTLTSFAKP--LIDFTLFTSLIFREPFTH 188

  Fly   434 ------CLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYAN--TFS 490
                  .||...|..||||.:|.....::  |.||.|||.. |.:||.|.|.....|..|  ...
Yeast   189 FDLSVALLPVLVRLLQCLREYRLLHEATL--LFNALKYSCN-LPILFCTWRSRVYEGSINEERLH 250

  Fly   491 NPYTWLFLSSCVVATIYCYLWDVIRDFGL-----FRIMRGERIFLRKQLVYPQAFYYFVIVENLV 550
            :...|..|    :.:.|...|||..|:.|     .|......:.|:|::      |:..|:.:.:
Yeast   251 HVQRWFML----INSSYTLFWDVRMDWSLDSLTSLRSRSKSAVTLKKKM------YHSAILVDFL 305

  Fly   551 LRLFWAVEFTILYHNLMTPYNMRTISS------------ILEITRRFIWNYVRLENEH 596
            ||.:|...:        ...|::.:::            ..|:.||.||...:|:.|:
Yeast   306 LRFWWLWVY--------LSQNLKLVAADSDYIFFQGEMQYFEVIRRGIWVVFKLDAEY 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695
SPX_XPR1_like 2..158 CDD:269898
EXS 260..597 CDD:281164 77/384 (20%)
ERD1NP_010702.4 COG5409 1..362 CDD:227696 77/384 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.