DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and PHO1;H1

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_564940.1 Gene:PHO1;H1 AraportID:AT1G68740 Length:784 Species:Arabidopsis thaliana

Alignment Length:837 Identity:199/838 (24%)
Similarity:316/838 (38%) Gaps:261/838 (31%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQ------GVEN------------------------ 35
            :||.|.:|..|..||:..::.|..||:.:|:      |||.                        
plant     2 VKFTKQFEGQLVPEWKDAFVDYSQLKKDLKKIHLFTNGVEKKHTETSLIKTVKSSLGRLSIFGNK 66

  Fly    36 --------------APSPLTSSDYEVQAYYKAFEET-----FLTECQSELTGVNNF-------FL 74
                          |.|...:..||.:...|..::|     |......:|..||.|       ||
plant    67 GREQSRVIQVHKKLASSGSNNDVYETELLEKIADDTDAAKEFFACLDMQLNKVNQFYKTKEKEFL 131

  Fly    75 EK----------LLE----------------------------------ARRKHGHLKLQLLAY- 94
            |:          |:|                                  .|.:...::||:... 
plant   132 ERGECLKKQMDILIELKDAFKQKQANGESTQESKEDDSISCTISCEYDSVRGRTEEMQLQVSCLD 196

  Fly    95 --------------SREP-GHTGSDSSLSQRAER------------------------------- 113
                          |.|| .....||.|:..:.|                               
plant   197 NLEDNGEEALESLGSEEPIKANNEDSKLTTVSSRVFSCQGKNVKIKIPLTNPSRTFSAISYLINQ 261

  Fly   114 ----------------SQKKLM-TTRQLRYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMR 161
                            |:|||. ..:.::.|..|.:..|..::.|::||...|..|.||:||   
plant   262 SSSKKNGPDGGNKLQISKKKLSHAEKMIKGALTELFKGLNYLKTYRNLNILAFMNILKKFDK--- 323

  Fly   162 SVAAGRWFVE---NVLDAPFTDVR-LLQRMTIEVEDLYTTHLANGDRSLAMEKLRVPPLGEPTPP 222
              ..|:..:.   .|:::.:.::. .:..::.|||:.:..|||..:|..||:.|:  |.......
plant   324 --VTGKQILPIYLKVVESSYFNISDKVMILSDEVEEWFIKHLAGENRRKAMKYLK--PHHRKESH 384

  Fly   223 SMVFRAGIALGMLIMLLVATAISYWKRAPLEDHTPGLMRLFRGPFTWVIFNFYM----------- 276
            |:.|..|:..|..:.||....|        ..|..|:.|.....      .|||           
plant   385 SVTFFIGLFTGCFVALLAGYII--------VAHLTGMYRQHSAN------TFYMETAYPVLSMFG 435

  Fly   277 ---------AANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIACT------FGILWA-LSML-- 323
                     ..|:..|::|.:|:..|||:..::.|:..... :.||      .|:::. ||:|  
plant   436 LLFLHLFLYGCNIFMWRKARINYSFIFELGSKNELKYRDVF-LICTASMSAIAGVMFVHLSLLEK 499

  Fly   324 GFLYNDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPARWWTIKLVGRVITAPLHYVGFADFWM 388
            |:.:..:..:  |.:..||.:||    |:.||.|....:|:..|.::..::.:||:.|...||:|
plant   500 GYSFRQVQVI--PGLLLLGFLLI----LICPLNIFYKSSRYRLISVIRNIVFSPLYKVVMLDFFM 558

  Fly   389 GDQMNSLVSCI-----VDHYYTVRFYAISWLRY-DRVNNCFEPDVMVPITMCLPGWFRFAQCLRR 447
            .||:.|.|..:     :..||....||.....| .||.  :..|:...::. ||.::|..||.||
plant   559 ADQLCSQVPMLRNLEYIACYYITGSYATQDYEYCMRVK--YYRDLAYAVSF-LPYYWRAMQCARR 620

  Fly   448 FRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYANTFSNPYTWLFLSSCVVATIYCYLWD 512
            :.|.|  ..|:|:|.|||.:..|..       .::..|....|..:..|.::...|||||...||
plant   621 WFDEG--ETSHLVNLGKYVSAMLAA-------GTKVAYEKERSLGWLCLVVAMSSVATIYQLYWD 676

  Fly   513 VIRDFGLFRIMRGERIFLRKQLVYPQ-AFYYFVIVENLVLRLFWAVEFTILYHNLMTPYNMRTIS 576
            .::|:||.: ......:||.||:..| :.|||.:|.||||||.|..  |:| |:.....:.|...
plant   677 FVKDWGLLQ-HNSNNPWLRNQLMLRQKSIYYFSMVLNLVLRLAWLQ--TVL-HSSFEHVDYRVTG 737

  Fly   577 ---SILEITRRFIWNYVRLENEHLFNCGNFRATRDIHLAALNPRQERMLESMMDESD 630
               :.||:.||..||:.|||||||.|.|.|||.:.:.|    |.:|      :||.|
plant   738 LFLAALEVIRRGQWNFYRLENEHLNNAGKFRAVKTVPL----PFRE------VDEED 784

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 56/325 (17%)
SPX_XPR1_like 2..158 CDD:269898 55/320 (17%)
EXS 260..597 CDD:281164 109/376 (29%)
PHO1;H1NP_564940.1 SPX_PHO1_like 3..331 CDD:269897 57/333 (17%)
SPX 4..336 CDD:281146 56/337 (17%)
EXS 444..761 CDD:281164 105/340 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.