DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and AT1G35350

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_174768.2 Gene:AT1G35350 AraportID:AT1G35350 Length:751 Species:Arabidopsis thaliana

Alignment Length:775 Identity:198/776 (26%)
Similarity:318/776 (41%) Gaps:200/776 (26%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIK-----------QGVEN------------------- 35
            |||||.|.:.:..||:|.||.|..||.:::           |||..                   
plant     1 MKFGKEYVAQMIPEWQQAYMDYTCLKTILREIKTSQKRSESQGVLKRKLSGRRNFSGLTKRYSRT 65

  Fly    36 -APSPLTSSDYEVQAY-----YKAFEETFLTEC----QSELT----------GVNNFFLEKLLEA 80
             :...|.:.|..|.|.     ::.:|.|.|...    :|||.          .||.|:...:.|.
plant    66 FSSRDLENHDIMVHATTGDDGFEKYETTILKVSEVGRESELVFFKTLDLEFDKVNRFYRSNVEEL 130

  Fly    81 RRKHGHLKLQ---LLAY--------------------------SREPGHT--------------- 101
            .::...|..|   |:||                          ..:.|.|               
plant   131 VKEAVVLNRQMDALIAYRIKLDQPSTSWSCSETVSVDINALDSKEQKGKTLAEEMGIKVEENVSN 195

  Fly   102 GSDSSLSQ-----------RAERSQKKLMTT------------------------RQLRYAYAEF 131
            |.||:...           |..::|:..::|                        .:|:..:.||
plant   196 GGDSTKETAPEALSVLDRIRLNKNQENPLSTIRNVLKLSNKEDIKFTKENLKKIEERLKNVFIEF 260

  Fly   132 YLSLVLIQNYQSLNETGFRKICKKYDK-NMRSVAAGRWFVENVLDAPFTDVRLLQRMTIEVEDLY 195
            |..|..::||..||.....||.||||| .:|:  |.:.::|.|..:..|....:.::.:.||.::
plant   261 YRKLRHLKNYSFLNTLAISKIMKKYDKIALRN--AAKLYMEMVDKSYLTSSDEINKLMLRVESIF 323

  Fly   196 TTHLANGDRSLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAISYWKRAPLEDHTPGLM 260
            ..|.|..:||..|..||  |........:.|..|..:|..:.|::|..:..        |...:|
plant   324 VEHFAGSNRSKGMNLLR--PKVTKEKHRITFSTGFFVGCTVSLVIALGLFI--------HARNIM 378

  Fly   261 -----RLFR-------GPFTWVIFNFYM-AANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIAC 312
                 :|:.       ..|.:|:.:..| |:|:..|::..||:..||.....:.|.....|.:  
plant   379 GAVGHKLYMETMFPLYSLFAFVVLHMIMYASNIYFWKRYRVNYPFIFGFKEGTELGYGHVLLL-- 441

  Fly   313 TFGILWALSMLGFLYN-DLIGVSDP---------YVFPLGLILIMVGLLVVPLPIMNWPARWWTI 367
            :|| |..|::...|.| |:  ..||         .:.||.::.:::.:.|.|..|....:|::.:
plant   442 SFG-LGTLALCAVLVNMDM--EMDPNTNDYKTITELVPLFVVALVIAISVCPFNIFYRSSRFFFL 503

  Fly   368 KLVGRVITAPLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRY-DRVNNCFEPDVMVP- 430
            .::.|.|.|||:.|...||::.||:.|.|..:....:.:.:|  .|..: .|.:.|...||... 
plant   504 MVLFRCIAAPLYKVNLPDFFLADQLTSQVQALRSLEFYICYY--GWGDFKQRQSTCKSSDVYSTF 566

  Fly   431 --ITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFST---LRRNSEGGYANTFS 490
              |...:|.|.||.||:||..:  .|.:|...||.||..|.:.|...|   :.|.::...|    
plant   567 YFIVAVIPYWSRFLQCVRRLIE--EKDVSQGFNALKYLLTIVAVCLRTAFSINRGNDWKIA---- 625

  Fly   491 NPYTWLFLSSCVVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYP-QAFYYFVIVENLVLRLF 554
               .|:|..   :||.|...||::.|:||  :.|..:.:||::|:.| ::.||..:|.|:||||.
plant   626 ---AWVFSG---LATFYGTYWDIVYDWGL--LHRPSKSWLREKLLVPHKSVYYVAMVVNVVLRLA 682

  Fly   555 W---AVEFTILYHNLMTPYNMRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDIHL 611
            |   .::|.|.:.:..|   |..:.:||||.||.|||:.|||||||.|.|.|||.:.:.|
plant   683 WLQTVLDFNISFLHRET---MVALIAILEIIRRGIWNFFRLENEHLNNVGKFRAFKSVPL 739

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 61/291 (21%)
SPX_XPR1_like 2..158 CDD:269898 58/285 (20%)
EXS 260..597 CDD:281164 110/371 (30%)
AT1G35350NP_174768.2 SPX_PHO1_like 2..295 CDD:269897 61/295 (21%)
SPX 3..300 CDD:281146 61/299 (20%)
EXS 391..725 CDD:281164 108/358 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.