DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and AT1G26730

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_173995.1 Gene:AT1G26730 AraportID:AT1G26730 Length:750 Species:Arabidopsis thaliana

Alignment Length:761 Identity:198/762 (26%)
Similarity:316/762 (41%) Gaps:173/762 (23%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQ-------------------GVENAPSPLT----- 41
            |||||.:...:..||:|.||.|..||.::::                   |..|. |.||     
plant     1 MKFGKDFVRQMIPEWQQAYMDYAGLKSILQEIQTSRKRSERPGILKRKLSGSRNF-SGLTKRYSR 64

  Fly    42 ---SSDYEVQAY----------YKAFEETFLTECQS--------------ELTGVNNFFLEKLLE 79
               :.:.|:|..          ::.:|.|.|...::              |...||:|:..|:.|
plant    65 TASTREPEIQDILVHATTGDDGFERYETTILEVAEAGRESELAFFKTLDLEFDKVNHFYRSKVEE 129

  Fly    80 ARRKHGHLKLQ---LLAYS---REP-------------------------------------GHT 101
            ..::...|..|   |:|:.   ..|                                     |..
plant   130 MVKEAVVLNKQMDALIAFRIKVERPSSSWSCSETVSVDMNALDSNDQRNTLAEEMGIRVEGNGSN 194

  Fly   102 GSDSS---------------LSQRAE------------RSQKKLMTTRQ--------LRYAYAEF 131
            |.||:               |::..|            .:|::|..||:        |:..:.||
plant   195 GGDSTKESVPQVLSVLERIRLNKTQETPLSTIKNVLKLSNQEELKFTRENLKKIEERLKNVFIEF 259

  Fly   132 YLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMTIEVEDLYT 196
            |..|..::||..||.....||.||||| :.|.:|.:.::|.|..:..|....:.::.:.||..:.
plant   260 YRKLRHLKNYSFLNTLAISKIMKKYDK-IASRSAAKPYMEMVDKSYLTSSDEINKLMLRVESTFV 323

  Fly   197 THLANGDRSLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAISYWKRAPL--EDHTPGL 259
            .|.|..:||..|..||  |..:.....:.|..|..:|..:.|:||..:....|..:  ..|...:
plant   324 EHFAGLNRSKGMNLLR--PKVKKEKHRITFSTGFFVGCTVSLVVALVMFIHARNIMGAVGHKVYM 386

  Fly   260 MRLFRGP----FTWVIFNFYM-AANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIACTFGILWA 319
            ..:|  |    |.:|:.:..| |:|:..|::..||:..||.....:.|.....|.::...|.|..
plant   387 ETMF--PLYSLFAFVVLHMIMYASNIYFWKRYRVNYPFIFGFKEGTELGYRHVLLLSFGLGTLAL 449

  Fly   320 LSMLGFLYNDLIGVSDPY-----VFPLGLILIMVGLLVVPLPIMNWPARWWTIKLVGRVITAPLH 379
            .::|..|..::...::.|     :.|:.::.::|.:|..|..|....:|.:.:.:|.|.|.|||:
plant   450 CAVLINLDMEMDPNTNDYKTMTELLPMFILALVVAILFCPFNIFYRSSRVFFLMVVFRCIAAPLY 514

  Fly   380 YVGFADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRYDRVNNCFEPDVMVP---ITMCLPGWFRF 441
            .|...||::.||:.|.|..:....:.:.:|.....:: |.|.|...||...   |...:|.|.||
plant   515 KVNLPDFFLADQLTSQVQALRSLEFYICYYGWGDFKH-RQNTCRSSDVYSTFYFIVAVIPYWSRF 578

  Fly   442 AQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYANTFSNPY---TWLFLSSCVV 503
            .||:||..:....|..|  ||.||..|.:.|...|       .|:....|.:   .|:|   ..:
plant   579 LQCVRRLIEENDSSQGY--NALKYLLTVVAVCLRT-------AYSFNRGNIWKISAWVF---SAL 631

  Fly   504 ATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYP-QAFYYFVIVENLVLRLFWAVEFTILYHNL- 566
            ||.|...||::.|:||  :.|..:..||::|:.| :|.||..||.|:|||:.|..  |:|..|| 
plant   632 ATFYGTYWDIVFDWGL--LHRPSKHLLREKLLVPHKAVYYVAIVLNIVLRMAWLQ--TVLDFNLS 692

  Fly   567 -MTPYNMRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDIHL 611
             :....|..:.:.|||.||.|||:.|||||||.|.|.|||.:.:.|
plant   693 FLHRETMIALLAALEIIRRGIWNFFRLENEHLNNVGKFRAFKSVPL 738

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 60/290 (21%)
SPX_XPR1_like 2..158 CDD:269898 58/285 (20%)
EXS 260..597 CDD:281164 108/356 (30%)
AT1G26730NP_173995.1 SPX_PHO1_like 2..294 CDD:269897 61/294 (21%)
SPX 3..299 CDD:281146 61/298 (20%)
SPX <212..286 CDD:271919 21/74 (28%)
EXS 390..724 CDD:281164 108/353 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.