DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and AT1G14040

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_172857.2 Gene:AT1G14040 AraportID:AT1G14040 Length:813 Species:Arabidopsis thaliana

Alignment Length:828 Identity:204/829 (25%)
Similarity:318/829 (38%) Gaps:244/829 (29%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGV------ENAPS------------PLT------ 41
            |||||.:.|.:..||:|.||.|..||.|:|:.:      .||||            .||      
plant     1 MKFGKEFSSQMVPEWQQAYMDYDFLKTLLKEIITFKRRTNNAPSHGGAKTGGGLNRKLTLYRAFS 65

  Fly    42 -----------SSDYEVQAYYK------------------AFEETFLTECQ-------------- 63
                       :|.::|:...:                  .:|.|||...:              
plant    66 GLVSTPRHKRSNSSHDVEEGVQLTGSMRSGPILVNTTASHGYETTFLMAAEEGGEYELVFFRRLD 130

  Fly    64 SELTGVNNFFLEKLLEARRKHGHLKLQ---LLAY---------------SREPGHTGSDSSLSQR 110
            .|...|:.|:.:|:.|..::...|..|   |:|:               :.|.....||.:.|..
plant   131 DEFNKVDKFYRKKVEEVLKEAAMLNKQMDALIAFRVKVENPDGWRWEERTVEMTRLASDIATSAA 195

  Fly   111 A-------------ERSQK---------------------------------------------- 116
            |             .|||:                                              
plant   196 ALSASTPAGAKSMKVRSQEHMEAIQEGGSSRAGLMEDDEEDEDEQNETSVVSTGAIDNETTTSRM 260

  Fly   117 --------------KLMTTRQ-------------------------------LRYAYAEFYLSLV 136
                          |:..|::                               |:.|:.|||..|.
plant   261 RGARPSPIDVLGRVKINNTKETPRSTIKGVLKVSKQTDLKFSRENLMKVEESLKRAFIEFYQKLR 325

  Fly   137 LIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTD-----VRLLQRMTIEVEDLYT 196
            |:::|..||...|.||.||||| :.|..|.:.::: |:|:.:..     :||::|    ||..:.
plant   326 LLKSYSFLNVLAFSKILKKYDK-ITSRDATKPYMK-VVDSSYLGSSDEVMRLMER----VEATFI 384

  Fly   197 THLANGDRSLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAISYWKRAPLE-----DHT 256
            .|.||.:|:.||..||  |..:.....:.|..|.:.|.:..|:||.......|..||     ::.
plant   385 KHFANANRAKAMNILR--PKAKRERHRITFSTGFSAGCVFSLIVALVAIIRTRNLLEMEGQKEYM 447

  Fly   257 PGLMRLFRGPFTWVIFNFYM-AANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIACTFGILWAL 320
            ..:..|: ..|.:::.:..: |||:..|::..||:..||.....:.|.....|.:..:.|:|..|
plant   448 NTMFPLY-SLFGFIVLHIIVYAANIYYWRRYRVNYSFIFGFKQGTELGYRQVLLVGFSIGVLALL 511

  Fly   321 SMLGFLYNDLIGVSDP---------YVFPLGLILIMVGLLVVPLPIMNWPARWWTIKLVGRVITA 376
            .:|..|..:    :||         .:.||.|:..|..:||:|.......:|::.:..:...:.|
plant   512 CVLANLDME----ADPKTKAYQARTEILPLILLAAMFIVLVLPFNYFYRSSRFFFLTCLFHCLAA 572

  Fly   377 PLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRYDRVNNCFEPDV---MVPITMCLPGW 438
            ||:.|...||::|||:.|.|..|....:.:.:|.....|: |.:.|.|.||   ...|...:|..
plant   573 PLYKVTLPDFFLGDQLTSQVQAIRSIEFYICYYGWGDFRH-RKSTCKESDVYNTFFFIVAVIPYV 636

  Fly   439 FRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYANTFSNPYTWLFLSS--C 501
            .|..|||||..:..:....|  |..||..|.:.|...|.....:|..|        |..|::  .
plant   637 SRLLQCLRRLFEEKNPEQGY--NGLKYFLTIVAVCLRTAYSIQKGQVA--------WRVLAAVFS 691

  Fly   502 VVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYPQAFYYFV-IVENLVLRLFWAVEFTILYHN 565
            .:|.|:|..||.:.|:||.......| :||.:|:.||...||: :|.|::||..|..  |:|..|
plant   692 FIAAIFCTYWDFVHDWGLLNRTSKNR-WLRDKLLVPQKKVYFIAMVLNVLLRFAWIQ--TVLDFN 753

  Fly   566 --LMTPYNMRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDIHL 611
              .|....|..|.:.|||.||.|||:.|||||||.|.|.:||.:.:.|
plant   754 FSFMHRQTMVAIVASLEIIRRGIWNFFRLENEHLNNVGKYRAFKSVPL 801

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 65/350 (19%)
SPX_XPR1_like 2..158 CDD:269898 63/345 (18%)
EXS 260..597 CDD:281164 106/355 (30%)
AT1G14040NP_172857.2 SPX_PHO1_like 2..355 CDD:269897 66/354 (19%)
SPX 3..360 CDD:281146 65/359 (18%)
SPX <284..347 CDD:271919 17/63 (27%)
EXS 451..787 CDD:281164 106/355 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
66.070

Return to query results.
Submit another query.