DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and AT4G11810

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_192918.1 Gene:AT4G11810 AraportID:AT4G11810 Length:707 Species:Arabidopsis thaliana

Alignment Length:492 Identity:107/493 (22%)
Similarity:174/493 (35%) Gaps:145/493 (29%)


  Fly     3 FGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFE-----ETFLTEC 62
            |||..:.....||::.|:.|..:|:.:||             |..|....:.:     :.|....
plant     4 FGKKLKERSIEEWQEYYINYKLMKKKVKQ-------------YGPQIEVGSLDRRHVLKDFSRML 55

  Fly    63 QSELTGVNNFFLEK--LLEARRKHGHLKLQLLAYSREPGHTGSDS-SLSQRAERSQKKLMTTRQL 124
            ..::..:..|.||:  ||.:|       ||.|   ||...|..|. .|||.|           :|
plant    56 DHQIEKIALFMLEQQGLLSSR-------LQKL---REWHDTLQDEPDLSQIA-----------KL 99

  Fly   125 RYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQR--- 186
            |.||......|:.:..:..:|..|.|||.||:||.. ......::|:...|.|::.::.:.|   
plant   100 REAYRAVGQDLLKLLFFIDMNAIGIRKILKKFDKRF-GYRFTNYYVKTRADHPYSQLQQVFRHVG 163

  Fly   187 --MTIEVEDLYTTHLANGDRS-LAMEKLRVPPLGEPTPPS--------------MVFRAGIALGM 234
              ..:.........|.|.:.| |::....|.||.:|...|              :.|.|..||.|
plant   164 LGAVVGAISRNLHELQNNEGSYLSIYDQPVLPLQDPVVDSIKNAVDRLTHSTNFLNFMAQHALIM 228

  Fly   235 -----LIMLLVATAISYWKRAPLED---HTPGLMRLFRGPFTWVIFNFYM--------------A 277
                 |:||...      ::|..|:   |...|:......|.::: |.|:              |
plant   229 QDDEDLLMLPPD------EQAEKEEGRYHFMSLLLNLANTFLYMV-NTYIIVPTADDYSMSLGAA 286

  Fly   278 ANVAGWQQAGVNHILIFEI------DPRSHLQPATFLEIACTFG-ILWALSMLGFLYNDLIGVSD 335
            |.|.|.....:....:|..      ..:|:.:|..|..|...|| :|:||:              
plant   287 ATVCGVVIGAMAVAQLFSSVYFSAWSNKSYFKPLIFSSIVLFFGNLLYALA-------------- 337

  Fly   336 PYVFPLGLILIMVGLL-----------------VVPLPI-MNWPARWWTIKLVGRVITAPLHYVG 382
             |.|. .|.|:::|.|                 .|||.| |...|.:.:...:|......|..:.
plant   338 -YDFN-SLALLLIGRLFCGFGSARAVNRRYISDCVPLKIRMQASAGFVSASALGMACGPALAGLL 400

  Fly   383 FADFWMGD---QMNSLVSCIVDHYYTVRFYAISWLRY 416
            ..||.:.:   ..::|...::         |::||.|
plant   401 QTDFKIKNVTFNQDTLPGWVM---------AVAWLLY 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 44/167 (26%)
SPX_XPR1_like 2..158 CDD:269898 43/163 (26%)
EXS 260..597 CDD:281164 38/200 (19%)
AT4G11810NP_192918.1 SPX-MFS_plant 2..141 CDD:269900 44/172 (26%)
SPX 4..145 CDD:281146 45/176 (26%)
MFS 262..703 CDD:119392 38/194 (20%)
MFS_1 262..665 CDD:284993 38/194 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.