DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2901 and SPX3

DIOPT Version :10

Sequence 1:NP_570077.1 Gene:CG2901 / 31338 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_182038.1 Gene:SPX3 / 819120 AraportID:AT2G45130 Length:245 Species:Arabidopsis thaliana


Alignment Length:195 Identity:55/195 - (28%)
Similarity:89/195 - (45%) Gaps:35/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFGKTYESHL---TIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTEC 62
            |||||..:..:   ..|||.:::||.:||.||     ::|:|:              |..|:...
plant     1 MKFGKRIKEQIQESLPEWRDKFLRYKELKNLI-----SSPAPV--------------ESIFVGLL 46

  Fly    63 QSELTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQRAERSQKKLMTTRQLRYA 127
            .:|:...|.||:|:..:....|..|:.::.....:.||..         |.|::.:   .::|..
plant    47 NAEIDKFNAFFVEQEEDFIIHHKELQYRIQRLVEKCGHND---------EMSRENI---SEIRKD 99

  Fly   128 YAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMTIEVE 192
            ...|:..:||:.||.::|.||..||.|||||..|...... |::.||..||....|:.|:..|.|
plant   100 IVNFHGEMVLLVNYSNINYTGLAKILKKYDKRTRGGLRSP-FIQKVLHQPFFKTDLVSRLVREWE 163

  Fly   193  192
            plant   164  163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 SPX_XPR1_like 2..158 CDD:269898 42/158 (27%)
EXS 259..597 CDD:460816
SPX3NP_182038.1 SPX_AtSPX1_like 2..131 CDD:269902 43/159 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.