DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and SPX3

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_182038.1 Gene:SPX3 AraportID:AT2G45130 Length:245 Species:Arabidopsis thaliana

Alignment Length:195 Identity:55/196 (28%)
Similarity:89/196 (45%) Gaps:35/196 (18%)


  Fly     1 MKFGKTYESHL---TIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTEC 62
            |||||..:..:   ..|||.:::||.:||.||     ::|:|:              |..|:...
plant     1 MKFGKRIKEQIQESLPEWRDKFLRYKELKNLI-----SSPAPV--------------ESIFVGLL 46

  Fly    63 QSELTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQRAERSQKKLMTTRQLRYA 127
            .:|:...|.||:|:..:....|..|:.::.....:.||..         |.|::.:   .::|..
plant    47 NAEIDKFNAFFVEQEEDFIIHHKELQYRIQRLVEKCGHND---------EMSRENI---SEIRKD 99

  Fly   128 YAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMTIEVE 192
            ...|:..:||:.||.::|.||..||.|||||..|...... |::.||..||....|:.|:..|.|
plant   100 IVNFHGEMVLLVNYSNINYTGLAKILKKYDKRTRGGLRSP-FIQKVLHQPFFKTDLVSRLVREWE 163

  Fly   193  192
            plant   164  163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 46/164 (28%)
SPX_XPR1_like 2..158 CDD:269898 43/159 (27%)
EXS 260..597 CDD:281164
SPX3NP_182038.1 SPX_AtSPX1_like 2..131 CDD:269902 44/160 (28%)
SPX 3..143 CDD:281146 45/172 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
10.910

Return to query results.
Submit another query.