DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and AT2G03250

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001318190.1 Gene:AT2G03250 AraportID:AT2G03250 Length:719 Species:Arabidopsis thaliana

Alignment Length:781 Identity:169/782 (22%)
Similarity:268/782 (34%) Gaps:229/782 (29%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIK--------------------------QGVENAP-- 37
            |||||.:.|    ||:|.|:.|..||.|:|                          .|:..|.  
plant     1 MKFGKDFSS----EWQQAYVDYKYLKTLVKDINRFKRKTNLHGGQISLSSTVLEIEDGITTATIQ 61

  Fly    38 -SPLTSSDYEVQAYYKA-----FEETFLTECQSELTGVNNFFLEKLLEARRKHGHLKLQ---LLA 93
             |...|..||......|     :|..|......|...|..|:.||:.|..::...|..|   |:|
plant    62 VSSTASQRYETTFLMTAEKGGEYELVFFRRLDDEFNKVEKFYREKVDEVVKEAAVLNKQMDALIA 126

  Fly    94 Y--------------------------SREPG--------HTGSDSSLSQRAE------------ 112
            :                          ::.|.        ..|..|...:|::            
plant   127 FRLKMKEESTVEMARFALHGVVSPAELAKNPSMKVHMEAIEEGGSSRAGRRSDEDDYYTDEEDHN 191

  Fly   113 ----------------------------------------RSQKKLMTTRQLRY----------- 126
                                                    :|..|:....:|::           
plant   192 DVFFTPANNLSKMKSSSSAFIEVLDSIKINNTKEALQSNTKSVLKVSNHTELKFSRDNLRKIEEK 256

  Fly   127 ---AYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMT 188
               |:.||:..|..:::|..||.....||..|||| :.|..|.:.:::.|..:.......:.::.
plant   257 LICAFVEFHRKLWYLKSYSFLNVLALSKILTKYDK-ITSRDAAKSYMKMVDKSCLGSSDEVMKLM 320

  Fly   189 IEVEDLYTTHLANGDRSLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAISYWKRAPLE 253
            ..||..:.....||:|:..|..||..|..|  ...:.|..|...|.:..|:||.......|..|:
plant   321 ENVEATFIKQFTNGNRTKGMNILRPKPKRE--RHRLTFSTGFLGGCMFSLIVALVAIVRTRNILQ 383

  Fly   254 DHTPGLMRLFRGPF-TWVIFNFYM------AANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIA 311
            |  .|..:.....| .:.:|.|.|      |||:..|:|..||:..||.....:.|.....|.:.
plant   384 D--DGQKQYMNTMFPLYSLFGFIMLHMTMYAANIYFWRQYRVNYSFIFGFKQGTELGYKQVLFVG 446

  Fly   312 CTFGILWALSMLGFLYNDLIGVSDP---------YVFPLGLILIMVGLLVVPLPIMNWPARWWTI 367
            .:.|   ||::|..|.| |...:||         .:.||.|::.|..:||||..|....:|::.:
plant   447 FSIG---ALALLCVLAN-LDMETDPKTKDYQALTELLPLFLLIAMFVVLVVPFNIFYRSSRFFFL 507

  Fly   368 KLVGRVITAPLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRY-DRVNNCFEPDV---M 428
            ..:..::.|||:.|...||::.||:.|....:....:.:.:|  .|..: .|.|.|.:..|   .
plant   508 TTLFHMLAAPLYKVTLPDFFLADQLCSQAQTLRSIEFYICYY--GWGDFKQRKNTCKDSQVFNTF 570

  Fly   429 VPITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYA----NTF 489
            :.|....|.:.||.||:||..:..:....|  |..||....:.|..         |.|    :..
plant   571 LFIVSAFPFFSRFLQCMRRMLEEKNIEQGY--NGFKYIVIVVAVCL---------GMAYEVDDEK 624

  Fly   490 SNPYTWLFLS--SCVVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYP-QAFYYFVIVENLVL 551
            .....|..|.  :..:|.::|..||::.|:||.. ...:..:||..|:.| :..|...:|.:   
plant   625 DRQIIWRLLGGITSAMAVVFCTYWDLVYDWGLLN-RTSKNPWLRDNLLIPHKEVYVLAMVSD--- 685

  Fly   552 RLFWAVEFTILYHNLMTPYNMRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDIHLAALNP 616
                                  .||:||..|   .|:          .||...|....||..|.|
plant   686 ----------------------NISTILRWT---TWH----------GCGRCLAKSWYHLVLLRP 715

  Fly   617 R 617
            :
plant   716 Q 716

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 54/298 (18%)
SPX_XPR1_like 2..158 CDD:269898 52/293 (18%)
EXS 260..597 CDD:281164 85/364 (23%)
AT2G03250NP_001318190.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
66.070

Return to query results.
Submit another query.