DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and AT2G03240

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_178423.5 Gene:AT2G03240 AraportID:AT2G03240 Length:823 Species:Arabidopsis thaliana

Alignment Length:832 Identity:194/833 (23%)
Similarity:305/833 (37%) Gaps:242/833 (29%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRY----GDLKELIK------------------------------- 30
            |||||.:.|.:..||.:.||.|    ..|||:||                               
plant     1 MKFGKEFSSQMVPEWHEAYMDYDYLKSQLKEIIKFKRKTNPHGPHHHHHHLLHRKMTLHRAFSGL 65

  Fly    31 ----------------------------------QGVENAPSPL----TSSDYEVQAYYKAFEE- 56
                                              :|:::..:|:    .|..||. .:..|.|| 
plant    66 ISTSPKKKKHHGHGGGHGGGHQIGHFSDSDDDIEEGIKHVTAPILINSASHGYET-TFLMASEEG 129

  Fly    57 -----TFLTECQSELTGVNNFFLEKLLEARRKHGHLKLQ---LLAYSREPGH------------- 100
                 .|......|...|..|:.||:.|..::...|:.|   |:|:..:..|             
plant   130 GEYETVFFRRLDDEFNKVEKFYKEKVEEVMKEAVMLEKQMDALIAFRVKVEHPDGWPWEERTVEM 194

  Fly   101 ---------------------------------------------TGSDSSLSQRAERSQ----- 115
                                                         ..||......||:.:     
plant   195 TQLASDVANSAAAVAASTPAGARSMKVGAQAHMEAIQEGGSSKAGKSSDEEDDDDAEKEEDNGVS 259

  Fly   116 -------KKLMTTR-----------------------------------------------QLRY 126
                   :|:...|                                               :||.
plant   260 GEVSGDVRKMKAGRPPPIEVLDRVKFNHTKETPRSTIKSVLQASNLTELKFSRENLRKVEAKLRR 324

  Fly   127 AYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMTIEV 191
            |:.|||..|.|:::|..|||..|.||.||||| :.|..|.:.:::.:.::.......:.|:...|
plant   325 AFVEFYQKLRLLKSYSFLNELAFSKILKKYDK-ITSRHASKSYMKMIDNSYLGSSDEVTRLVERV 388

  Fly   192 EDLYTTHLANGDRSLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAISYWKRAPLED-- 254
            |..:..|.:|.:||..|..||  |..:.....:.|..|...|.|..|:||.......|..|::  
plant   389 EATFIKHFSNANRSKGMNILR--PKAKRERHRITFSTGFLGGCLFSLVVALFAIIRTRNILQEEG 451

  Fly   255 ---HTPGLMRLFRGPFTWVIFNFYM-AANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIACTFG 315
               :...:..|: ..|.:|:.:..| |.|:..|::..||:..||.....:.|.....|.:..:.|
plant   452 QKQYMNTMFPLY-SLFGFVVLHILMYAGNIYYWRRYRVNYSFIFGFKHGTELGYRQVLFVGLSIG 515

  Fly   316 ILWALSMLGFLYNDLIGVSDPY-----VFPLGLILIMVGLLVVPLPIMNWPARWWTIKLVGRVIT 375
            :...|.:|..|..::...:..|     :.||.|:..|..:||:|..|....:|::.:..:...:.
plant   516 VFALLCILANLDMEVDPETKDYQALTELLPLFLLTGMFVVLVLPFNIFYRSSRFFFLTCLFHCLA 580

  Fly   376 APLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYA--ISWLRY-DRVNNCFEPD---VMVPITMC 434
            |||:.|...||.:|||:.|.|..:    .:::||.  ..|..| .|:|.|.|.|   ..:.|...
plant   581 APLYKVTLPDFLVGDQLTSQVQAL----RSIQFYICHYGWGDYKHRINTCTESDAYNAFLFIVAV 641

  Fly   435 LPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYANTFSNPYTWLFLS 499
            :|...|..|||||..:..:....|  |..||..|.:.|...|.       |:....|.:.|..|:
plant   642 IPYVSRLLQCLRRLFEEKNPEQGY--NGLKYFLTIVAVCLRTT-------YSVDEDNQFIWRILA 697

  Fly   500 S--CVVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYPQAFYYFV-IVENLVLRLFWAVEFTI 561
            .  ..:|.|:|..||::.|:||.. ...:..:||.:|:.||...||: ::.|::||..|..  |:
plant   698 GIFSAIAAIFCTYWDLVYDWGLLN-RTSKNPWLRDKLLVPQKKVYFIAMILNILLRFAWLQ--TV 759

  Fly   562 LYHN--LMTPYNMRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDIHL 611
            |..|  .|....|..:.:.|||.||.|||:.|||||||.|.|.:||.:.:.|
plant   760 LDFNFSFMHRQTMVAVVASLEIIRRGIWNFFRLENEHLNNVGKYRAFKTVPL 811

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 62/360 (17%)
SPX_XPR1_like 2..158 CDD:269898 60/355 (17%)
EXS 260..597 CDD:281164 104/354 (29%)
AT2G03240NP_178423.5 SPX_PHO1_like 2..364 CDD:269897 63/364 (17%)
SPX 3..369 CDD:281146 62/368 (17%)
SPX <286..356 CDD:271919 19/70 (27%)
EXS 460..797 CDD:281164 104/354 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
66.070

Return to query results.
Submit another query.