DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and xpr1b

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001119862.1 Gene:xpr1b ZFINID:ZDB-GENE-060503-266 Length:693 Species:Danio rerio

Alignment Length:694 Identity:276/695 (40%)
Similarity:394/695 (57%) Gaps:83/695 (12%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            |||.:...:|:|.|||:||::|...||::....:.|||...:.:..|:.||..|||.|...|:.|
Zfish     1 MKFTEHLSAHITPEWRKQYIQYEAFKEMLYSAQDQAPSIEVTDEDTVKRYYAKFEEKFFQTCEKE 65

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLA-------YSREPG--HTGSDSSLSQRAERSQKKLMTT 121
            |..:|.|:.|||.||:|:...|:.:|.:       .||..|  |..:...|||: ||.:.:  ..
Zfish    66 LAKINTFYSEKLAEAQRRFATLQNELQSSLDAQRESSRAAGLRHRRTVFHLSQQ-ERCKHR--NI 127

  Fly   122 RQLRYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQR 186
            :.|:.|::||||||:|:||||:||.||||||.||:||...:.....|.|.:|..|||...:.:.:
Zfish   128 KDLQLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKIFETSRGADWRVAHVEVAPFYTCKKITQ 192

  Fly   187 MTIEVEDLYTTHLANGDRSLAMEKLRVPPLG--EPTPPSMVFRAGIALGMLIMLLVATAIS---- 245
            :..|.|.|.||.|..|||..||::|||||||  :|.|....||.|:..|:.:.|.|...|:    
Zfish   193 LISETETLVTTELEGGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLYCGVFVALTVTVIIAGVVK 257

  Fly   246 ----------YWKRAPLEDHTPGLMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRS 300
                      .|.          |:|::||.|..:.|.|.:..|..||:||||||:||||::||:
Zfish   258 LVEHFGDNTDVWP----------LIRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRN 312

  Fly   301 HLQPATFLEIACTFGILWALSMLGFLY--NDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPAR 363
            :|......|||...|:||.:|:|..|:  |.||.:   ::.||.|.......|:.||....:.:|
Zfish   313 NLSHQHLFEIAGFLGVLWCVSILSCLFAENTLIPI---HMNPLALYGFFFLFLINPLKTCYYKSR 374

  Fly   364 WWTIKLVGRVITAPLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAIS----------WLRY-D 417
            :|.:||:.||:|||.|.|||||||:.||:||||..::|..|.:.||::.          |::. :
Zfish   375 FWLLKLLFRVVTAPFHRVGFADFWLADQLNSLVVVLMDLEYMICFYSLELNWTMSEGELWIKEGE 439

  Fly   418 RVNNCFEPDVMV-PITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNS 481
            |:  |:.....| .:..|||.||||.|||||:||: .::..:|:|||||||||.||:|..|.:..
Zfish   440 RI--CYSYSYGVRAVIKCLPAWFRFVQCLRRYRDT-KRAFPHLVNAGKYSTTFFVVIFEALFKTH 501

  Fly   482 EGGYANTFSNPYTWLFLSSCVVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYPQ-AFYYFVI 545
            .|.....|    .::.::..:|.:.|..|||:..|:|||....||...||:::|||| |:||..|
Zfish   502 SGDERFVF----LYIMIACRIVNSCYTLLWDLKMDWGLFDRNAGENTLLREEIVYPQKAYYYCAI 562

  Fly   546 VENLVLRLFWAVEFTILYHNLMTPYNMRTISSI-------LEITRRFIWNYVRLENEHLFNCGNF 603
            ||:::||..|.:..     :|...|:...||:|       ||:.|||:||:.|||||||.|||.|
Zfish   563 VEDVILRFAWTIPL-----SLEVVYDRPVISNILGTVLPPLEVFRRFVWNFFRLENEHLNNCGEF 622

  Fly   604 RATRDIHLAALNPRQERMLESMMDESDGVSNRRKSNERIRLGKE 647
            ||.|||.:|.||...:.:||.|||:.|||.|        ||||:
Zfish   623 RAVRDISVAPLNADDQTLLEQMMDQEDGVRN--------RLGKK 658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 70/170 (41%)
SPX_XPR1_like 2..158 CDD:269898 68/165 (41%)
EXS 260..597 CDD:281164 145/359 (40%)
xpr1bNP_001119862.1 SPX_XPR1_like 2..164 CDD:269898 68/165 (41%)
SPX 3..172 CDD:281146 68/172 (40%)
Important for inositol polyphosphate binding. {ECO:0000250|UniProtKB:P43585} 157..164 5/7 (71%)
EXS 289..616 CDD:281164 139/342 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196187618
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.