DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and xpr1

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001016753.1 Gene:xpr1 XenbaseID:XB-GENE-1015946 Length:692 Species:Xenopus tropicalis

Alignment Length:677 Identity:272/678 (40%)
Similarity:393/678 (58%) Gaps:62/678 (9%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            |||.:...:|:|.|||:||::|...||::....:.|||...:.:..|:.||..|||.|...|:.|
 Frog     1 MKFAEHLSAHITPEWRKQYIQYEAFKEMLYAAQDQAPSIEVTDEDTVKRYYAKFEEIFFQTCEKE 65

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQL---LAYSRE----PGHTGSDSSLSQR---------AERS 114
            |..:|.|:.|||.||:|:...|:.:|   |...||    ||       |.||         .||.
 Frog    66 LAKINTFYSEKLAEAQRRSATLQNELQSSLDAQRESSAIPG-------LRQRRKAVFALTHEERV 123

  Fly   115 QKKLMTTRQLRYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFT 179
            |.:  ..:.|:.|::||||||:|:||||:||.||||||.||:||.:.:.....|.|.:|..|||.
 Frog   124 QHR--NIKDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHVEVAPFY 186

  Fly   180 DVRLLQRMTIEVEDLYTTHLANGDRSLAMEKLRVPPLG--EPTPPSMVFRAGIALGMLIMLLVAT 242
            ..:.:.::..|.|.:.|..|.:|||..||::|||||||  :|.|....||.|:..|:.|:|.:|.
 Frog   187 TCKKINQLISETETVVTNELESGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLYCGIFIVLNMAI 251

  Fly   243 AISYWKRAPLEDHTPGLMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRSHLQPATF 307
            .::.......:|..| ::|::||.|..:.|.|.:..|..||:||||||:||||::||::|.....
 Frog   252 IMAGSHYLLGKDVWP-MVRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHL 315

  Fly   308 LEIACTFGILWALSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPARWWTIKLVGR 372
            .|||...||||..|:...::...|.: ..::.||.|..:|:..||.|.....:.:|:|.:||:.|
 Frog   316 FEIAGFLGILWCFSLFSCIFGLWINL-QMHLNPLILYGLMLLFLVNPTKTFYYKSRFWLLKLLFR 379

  Fly   373 VITAPLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYA--ISWLRYD-------RVNNCFEPDVM 428
            |.|||.|.|||||||:.||:|||...::|..:.:.||:  :.|...|       .|.|.:...|.
 Frog   380 VFTAPFHKVGFADFWLADQLNSLAVILMDLEFMICFYSFELKWGDSDGLVNSANSVCNSYSYGVR 444

  Fly   429 VPITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTL------RRNSEGGYAN 487
            . :..|:|.|.||.|||||:||: .::..:|:|||||||||.:|.|:.|      |.:|:   |.
 Frog   445 A-VVQCIPAWLRFIQCLRRYRDT-KRAFPHLVNAGKYSTTFFMVTFAALYSTHKERNHSD---AQ 504

  Fly   488 TFSNPYTWL---FLSSCVVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYPQ-AFYYFVIVEN 548
            .|.  |.|:   .:|||     |..:||:..|:|||....||..|||:::|||| |:||..|:::
 Frog   505 VFF--YLWIIFYLISSC-----YTLIWDLKMDWGLFDRNAGENTFLREEIVYPQKAYYYCAIIQD 562

  Fly   549 LVLRLFWAVEFTILYHNLMTPYN--MRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDIHL 611
            ::||..|.::.::...||.|...  :.|:.:.||:.|||:||:.|||||||.|||.|||.|||.:
 Frog   563 VILRFAWTIQISVTSLNLFTDAGDIISTVLAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISV 627

  Fly   612 AALNPRQERMLESMMDESDGVSNRRKS 638
            |.||...:.:||.|||:.|||.||.||
 Frog   628 APLNADDQTLLEQMMDQDDGVKNRVKS 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 72/177 (41%)
SPX_XPR1_like 2..158 CDD:269898 70/172 (41%)
EXS 260..597 CDD:281164 142/358 (40%)
xpr1NP_001016753.1 SPX_XPR1_like 2..165 CDD:269898 70/172 (41%)
SPX 3..169 CDD:281146 70/175 (40%)
Important for inositol polyphosphate binding. {ECO:0000250|UniProtKB:P43585} 158..165 5/7 (71%)
EXS 269..613 CDD:281164 142/357 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.