DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and CG10483

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster

Alignment Length:652 Identity:248/653 (38%)
Similarity:379/653 (58%) Gaps:27/653 (4%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            |||.:...:|:|.|||:||:.|.::|.::...:|.:||........|..|:..|:|.|...|..|
  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAIEQSPSAELVEREMVTRYFAKFDEEFFHYCDKE 65

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQRAERSQKKLMTTR--QLRYAY 128
            |..:|.|:.||:.||.||:|.|:.: |..:.|.||.....:..:|....:|.:...:  .|:.|:
  Fly    66 LAKINTFYSEKMAEATRKYGSLRSE-LTEALEMGHPKKLPAWKRRTPLGKKNVPARKIQDLKLAF 129

  Fly   129 AEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMTIEVED 193
            :||||.|:|:||||:||.||||||.||:||.:......||..::|..|.|...:.:.|:..|.|.
  Fly   130 SEFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQETEQ 194

  Fly   194 LYTTHLANGDRSLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAIS--------YWKRA 250
            ..|..:..|||..||::||||||||...|...|:.|:..|..::|.:...|:        .|:..
  Fly   195 AVTQDIEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGAFVVLFITVVIAAMFYGFGENWRAG 259

  Fly   251 PLEDHTPGLMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIACTFG 315
                     ||:||.||..:...|....||.||:.:||||:||||:|||:||.....:|:|..||
  Fly   260 ---------MRMFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFG 315

  Fly   316 ILWALSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPARWWTIKLVGRVITAPLHY 380
            ::||..:|.:::.|.:|:.. |..||.|..:|...|:.|....:..||:|.|:::.|||.||..:
  Fly   316 VIWACCVLSYIFCDPLGIPQ-YAAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVIMAPFCF 379

  Fly   381 VGFADFWMGDQMNSLVSCIVDHYYTVRFYAIS--WLRYDR-VNNCFE-PDVMVPITMCLPGWFRF 441
            |.|||||:.||:||:|...:|..:.:.|:..|  |.:..: .::|.| ..::.||...:|.:|||
  Fly   380 VNFADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHCVEYVSLLHPIVAIMPAYFRF 444

  Fly   442 AQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYANTFSNPYTWLFLSSCVVATI 506
            |||:||:||: .:|..:|:||.||:|:|.||:|:.....:...|..:..||:.:.::::.:.::.
  Fly   445 AQCIRRYRDT-KESFPHLVNAAKYATSFFVVIFAHKYHTTTDTYPLSKENPWFYCWITAAIFSSC 508

  Fly   507 YCYLWDVIRDFGLFRIMRGERIFLRKQLVYPQA-FYYFVIVENLVLRLFWAVEFTILYHNLMTPY 570
            |.|.||:..|:|||....|:..|||:::||... ||||.|:|:|:||..|.:..:::....:...
  Fly   509 YAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLSMSLIEAGYIEGD 573

  Fly   571 NMRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDIHLAALNPRQERMLESMMDESDGVSNR 635
            .|.||.|.||:.|||||||.|||||||.|.|.|||.|||.:|.::...:..:..||||:|||.||
  Fly   574 VMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMDCSDQTTILRMMDETDGVLNR 638

  Fly   636 RK 637
            |:
  Fly   639 RR 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 63/163 (39%)
SPX_XPR1_like 2..158 CDD:269898 61/158 (39%)
EXS 260..597 CDD:281164 136/342 (40%)
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 61/158 (39%)
SPX 3..162 CDD:281146 61/160 (38%)
EXS 260..600 CDD:281164 136/342 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196152202
eggNOG 1 0.900 E1_COG5409
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10783
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.