DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and Y39A1A.22

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_499359.3 Gene:Y39A1A.22 WormBaseID:WBGene00012659 Length:710 Species:Caenorhabditis elegans

Alignment Length:692 Identity:246/693 (35%)
Similarity:379/693 (55%) Gaps:61/693 (9%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            ||||:...||||.|||:||:.|..||.|:...:...|    :.|...:.:....:|.|..||..|
 Worm     1 MKFGEQLASHLTPEWRKQYIDYERLKNLLYDDMMEVP----ADDDRREEHISRLDEKFFNECDQE 61

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQR---AERSQKKLMTTR---QL 124
            ||.:|.||.:|:.|.:.||..|:.:|..:....|.....:.:.:|   .::..|:  |||   ||
 Worm    62 LTKINLFFSQKIAEGQGKHHELQTELQVFKDVLGSRSDTTGIRRRFGGKDKFHKE--TTRNEQQL 124

  Fly   125 RYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMTI 189
            :.|::||||||||:||:|.||.||||||.||:||...:.....|.:..|..:.|...|.::.:..
 Worm   125 KLAFSEFYLSLVLVQNFQQLNATGFRKILKKHDKLTGNERGLDWRINKVEKSSFFLNREIETLIT 189

  Fly   190 EVEDLYTTHLANGDRSLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAISYWKRAPLED 254
            .||......|..|:|...|::|:||||.|...|...|..|:.:|..|:||:|..:: |..:|...
 Worm   190 NVETSVINDLEAGNRQAGMKRLKVPPLSEKQKPLTTFSLGLFIGASIILLLAILLT-WIASPARP 253

  Fly   255 HTPG--LMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIACTFGIL 317
            ..|.  .:||||||....:..|....|:|||..|||||:||||:|||:||...|.::||....:|
 Worm   254 QEPKWVAVRLFRGPLLLFLSIFLCGVNMAGWAAAGVNHVLIFEVDPRNHLSYQTLMQIASFMIML 318

  Fly   318 WALSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVPL----PIMNWPARWWTIKLVGRVITAPL 378
            |:.::|.:||..::.: .|:..||.|:::.:.||:.|:    .:.:..:|:|.:|...:..|:|.
 Worm   319 WSFAVLAYLYAHMLHI-PPFAPPLALMVVCLILLLNPIAKPDSVFHRNSRFWLLKHCYKCFTSPF 382

  Fly   379 HYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAI------SWLRYDRVNN---------------- 421
            |:|.|.|||:|||||||.:..:|..|.|.|||.      .|:....:|:                
 Worm   383 HFVTFTDFWLGDQMNSLTTAFLDFQYFVCFYATEVDYSNGWIEVKGINSTTGSVPWGSVELSNGK 447

  Fly   422 --CFEPDVMVPITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGG 484
              |.....:..:...:|...||.|||||:||: .:...:|:|||||||||.||....|.:..|..
 Worm   448 DQCASAAGLRSLMSIIPAMIRFLQCLRRYRDT-KRVHPHLVNAGKYSTTFFVVACGALNKYYEAT 511

  Fly   485 YANTFSNPYTWLFLSSCVVATIYCYLWDVIRDFGLF--RIMRGERIFLRKQLVYPQAFYYFV-IV 546
            ..|| ::.:.::::.|.:::..|.:|||:..|:||.  |..:..| |||::::|...:||:: |.
 Worm   512 DPNT-TSIFFYIWILSYIMSFTYTFLWDIFMDWGLIDPRAPKEAR-FLREEMIYGSKWYYYMAIA 574

  Fly   547 ENLVLRLFWAVEFTI-----LYHNLMTPYNMRTISSILEITRRFIWNYVRLENEHLFNCGNFRAT 606
            ::.||||.|.:..::     |..:.:|     |:::..|:.|||||||.||||||:.|||.|||.
 Worm   575 QDFVLRLAWVLNVSLGEAWTLDSDFLT-----TVTAPFEVFRRFIWNYFRLENEHVNNCGQFRAV 634

  Fly   607 RDIHLAALNPRQERMLESMMDESDGVSNRRKS-NERIRLGKE 647
            |||.:..:.......|.|.||:.|||::|.:. .||::..|:
 Worm   635 RDISVKPIRKGDLESLLSKMDQMDGVTHRGQDLMERVKKQKK 676

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 67/167 (40%)
SPX_XPR1_like 2..158 CDD:269898 65/162 (40%)
EXS 260..597 CDD:281164 132/373 (35%)
Y39A1A.22NP_499359.3 SPX_XPR1_like 2..158 CDD:269898 65/162 (40%)
EXS 262..625 CDD:308637 132/372 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.682 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.830

Return to query results.
Submit another query.