DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and CG10481

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_995731.1 Gene:CG10481 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster

Alignment Length:658 Identity:305/659 (46%)
Similarity:413/659 (63%) Gaps:21/659 (3%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            ||||||.::.:..|||.|||.|.:||::|:..||.|||....|:.....||:.|||.|...|:.|
  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQL---LAYSREPGHT---GSDSSLSQRAERSQKKLMTTRQL 124
            ||.||.||..|..||.||...|..||   .|.....|.|   ||.||.|::.| .::|....::|
  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQPE-GKRKFPPIKKL 129

  Fly   125 RYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMTI 189
            |.|.:||||||:::||||:||.|.|||||||||||::|.|...|:.:.||.:.......|.||..
  Fly   130 RLAMSEFYLSLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYVLKSTLAITLQLDRMIS 194

  Fly   190 EVEDLYTTHLANGDRSLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAISYWKRAPLED 254
            ..|::||.:|||||||.||.||||||||.||||..||.||:.||:.::..:...|||:......:
  Fly   195 TTENMYTDYLANGDRSEAMAKLRVPPLGHPTPPVHVFSAGLFLGLFLVSAILCFISYFAVDTSPE 259

  Fly   255 HTPGLMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIACTFGILWA 319
            .....:.|||||.:.|.|.|.:|.|:..::..|||.:||||::.|:.:.....|||:..||.:..
  Fly   260 FRYTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSFFGYMCT 324

  Fly   320 LSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPARWWTIKLVGRVITAPLHYVGFA 384
            ||:|.:|.:....:.||...||..:..:|.|.:.|..|:.:..|.|.:.::||::.:|..:|.||
  Fly   325 LSILLYLLHKEFFIEDPIYIPLVQVAFVVVLFLNPFRILFYSGRIWLLTVMGRILLSPFFFVNFA 389

  Fly   385 DFWMGDQMNSLVSCIVDHYYTVRFYAISWLRY--DRVNNC-FEPDVMVPITMCLPGWFRFAQCLR 446
            |||:.||..|||..||||||.||||    :||  ||.:.. ||||..|.:..|||.||||||.||
  Fly   390 DFWVADQWTSLVVTIVDHYYLVRFY----VRYFLDRSDAFEFEPDYAVAVIRCLPAWFRFAQSLR 450

  Fly   447 RFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYANTFSNPYTWLFLSSCVVATIYCYLW 511
            |||||||||..|||||.||......|:|||::..:...|.:.|.:|:||.:::.|:|::||...|
  Fly   451 RFRDSGSKSTDYLINALKYFLFIAEVVFSTIQMETIAHYTDLFESPWTWAYITICIVSSIYTVFW 515

  Fly   512 DVIRDFGLFRIMRGERIFLRKQLVYPQAFYYFVIVENLVLRLFWAVEFTILYHNLMTPYNMRTIS 576
            |::.||||||:..||..|||..||||:.|||||||||.:||..|.:||.:::..|:.|||.:::.
  Fly   516 DLLMDFGLFRVWNGENKFLRDNLVYPRWFYYFVIVENTLLRCVWILEFALVHQELIAPYNGKSLI 580

  Fly   577 SILEITRRFIWNYVRLENEHLFNCGNFRATRDIHLAALNPRQERMLESMMDESDGVSNRRKSNER 641
            ...||.|||.||::|||||||:|||.|||||||.:..|:|::||.|||:||.::.:.       |
  Fly   581 CFSEIARRFFWNFLRLENEHLYNCGQFRATRDIFITRLDPQEERFLESVMDNTEDLG-------R 638

  Fly   642 IRLGKEYF 649
            .:|.|:||
  Fly   639 EKLNKKYF 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 81/167 (49%)
SPX_XPR1_like 2..158 CDD:269898 78/162 (48%)
EXS 260..597 CDD:281164 158/340 (46%)
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 78/162 (48%)
SPX 3..163 CDD:281146 77/161 (48%)
EXS 267..601 CDD:281164 158/338 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196152104
eggNOG 1 0.900 E1_COG5409
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10783
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.