DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and SPCC1827.07c

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_588554.2 Gene:SPCC1827.07c PomBaseID:SPCC1827.07c Length:682 Species:Schizosaccharomyces pombe

Alignment Length:708 Identity:186/709 (26%)
Similarity:300/709 (42%) Gaps:111/709 (16%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSP--------LTSSDYE-------VQAY 50
            |||||..|.....||...|..|...|::| .|:...||.        |..:..|       :..:
pombe     1 MKFGKVIEGQSVAEWASAYFDYKKGKKII-AGIAKNPSEGLYGTSGILGETPEEAIVKRGQIHRF 64

  Fly    51 YKAFEETFLTECQSELTGVNNFFLEKLLEARRKHGHLKLQ------LLAYSREPGHTGS------ 103
            :..|:| ||.:   :...|..||...:.:||.:...:..|      |.|:.:....:||      
pombe    65 HPLFQE-FLDQ---QANKVEEFFENLVSDARERMDLISDQVDIYEKLRAFKKGTLESGSVVLIQK 125

  Fly   104 -DSSLSQRAER----------------------------SQKKLMTTRQLRYAYAEFYLSLVLIQ 139
             .|.|.||.:.                            |.:||.:  :|:....:||..|.|:.
pombe   126 QHSKLRQRLDSILNFSRLQPAYHIPARKSVPTDAYTPMVSYRKLKS--KLKTTLLDFYDYLKLVS 188

  Fly   140 NYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMTIEVEDLYTTHLANGDR 204
            .||.||:..||||.|||||.:.:...|.| |:.:....|||..:.....:.|||:|.....|.::
pombe   189 QYQHLNQQAFRKIVKKYDKTLHTDLQGFW-VDYMSRYTFTDFSITTNWQLHVEDIYARLFTNHNK 252

  Fly   205 SLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAISYWKRAPLEDHTPGLMRLFRGPFTW 269
            .||:|.|:.....|....:.: |.|:..|..:.|.:..|..|    ...:.:..|:::: |.|..
pombe   253 KLALEHLKSFRQKEHFSANSM-RFGLLFGAGLPLAIEAACYY----NATEQSSYLLQIW-GGFFL 311

  Fly   270 VIFNFYM-AANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIA----CTFGILWALSMLGFLYND 329
            |||.|.: ..:...|::..||::||||.:.|..|.....|||.    ..|.:.:.|.|..|....
pombe   312 VIFAFVLFDLDCYVWEKTRVNYMLIFEFNQRKSLNWRQHLEIVGAVFFIFSLFFFLCMRNFFPGF 376

  Fly   330 LIGVSDPYVFPLGLILIMVG-LLVVPLPIMNWPARWWTIKLVGRVITAPLHYVGFADFWMGDQMN 393
            .|      .|| .|.|.:|| .|:.|:.:..|..|.:.|..:.||..:.|..|.|.||:..|||.
pombe   377 TI------YFP-ALFLGVVGTFLIAPVIVPYWRMRRYLIIQLIRVFLSGLSTVHFQDFFFADQMV 434

  Fly   394 SLVSCIVDHYYTVRFYAISWLRYDRVNNCFEPDVMVPITMCLPGWFRFAQCLRRFRDSGSKSMSY 458
            ||.....:.......|...|.:....|:...|  ::.....|||..|..||.||:.|| .||..:
pombe   435 SLTYACGNISLFFCLYKRLWRQPQLCNSSHSP--LLGFFTTLPGILRVFQCFRRYSDS-LKSFPH 496

  Fly   459 LINAGKYSTTFLVVLFSTLRRNSEGGYANTFSNPYTWLFLSSCVVATIYCYLWDVIRDFGLFRIM 523
            |:||.||....|..:|.:|.|...|       ..|..|:.....|.:::.|.||::.|:.|. :.
pombe   497 LVNALKYIFNILAQMFLSLWRIHPG-------LKYRVLYTIFAGVNSLFSYTWDILMDWNLL-VR 553

  Fly   524 RGERIFLRKQLVYPQAFYYFV-IVENLVLRLFWAVEFTILYHNLMTPYNMRTISSILEITRRFIW 587
            :..|...|:..:..|.:.|.: ::.|.::|..: :.:.|..:::.....:....::.||.||.:|
pombe   554 KDGRWQFREHRILKQLWPYIIAMILNFIVRSSF-IFYCIFPNHIQHSSGISFFVTLAEIMRRCMW 617

  Fly   588 NYVRLENEHLFNCGNFRATRDIH-LAALNPRQERML--------------ESMMDESD 630
            |.:|:|:|.::|..|.||.|::. |..:.|..:..:              :||.|::|
pombe   618 NILRVEHEEIYNRENLRAARELKPLDFVKPHSDVFVSHQISSDKNYTDDEDSMDDQTD 675

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 56/217 (26%)
SPX_XPR1_like 2..158 CDD:269898 54/212 (25%)
EXS 260..597 CDD:281164 96/344 (28%)
SPCC1827.07cNP_588554.2 COG5408 1..272 CDD:227695 72/279 (26%)
SPX_SYG1_like 2..207 CDD:269896 54/212 (25%)
COG5409 271..641 CDD:227696 108/395 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I1058
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T631565
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
88.030

Return to query results.
Submit another query.