DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and CG7536

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster

Alignment Length:655 Identity:276/656 (42%)
Similarity:398/656 (61%) Gaps:31/656 (5%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            |||.:...:|:|.|||:||:.|.::|.::...||.|||..:..|..::.::..|:|.|...|..|
  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFANFDENFFHYCDKE 65

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQRAERSQKKL-----------M 119
            |..:|.|:.|||.||.||...|..:|             .:..:.:|||.||.           .
  Fly    66 LKKINTFYSEKLAEATRKFATLNAEL-------------KTSIEESERSAKKSKGHKRHAALPDR 117

  Fly   120 TTRQLRYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLL 184
            ..|:|:.|::||||||:|:||||:||.||||||.||:||.:|.....:|..|.|..:.|...:.:
  Fly   118 KARELKLAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDI 182

  Fly   185 QRMTIEVEDLYTTHLANGDRSLAMEKLRVPPLGEPTPPSMVFRAGIALGMLIMLLVATAISYWKR 249
            ..:..|.|...|..|..|||..||::||||||||...|...|:.|:..|..|:|::...:|....
  Fly   183 DNIINETETTVTGELEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGSFIVLVIVVVVSAIFH 247

  Fly   250 APLEDHTPGLMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIACTF 314
            ....::.....||:|||...:.|.|.:..|:.||:.:||||:||||:|||:||.....:|:|..|
  Fly   248 EISGENLKVTFRLYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIF 312

  Fly   315 GILWALSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPARWWTIKLVGRVITAPLH 379
            |::|.||||.|||:..:.: ..::.||.|.||||..|..|..::...||:|..::.||.::||..
  Fly   313 GVIWTLSMLSFLYSASLAI-PAFINPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPFF 376

  Fly   380 YVGFADFWMGDQMNSLVSCIVDHYYTVRFYAI--SWLRYDRVNNCFEPDVMV-PITMCLPGWFRF 441
            :|||||||:|||:|||.:.|:|..|.:.||..  :|......:.|.|.|.:: ||..|||.||||
  Fly   377 HVGFADFWLGDQLNSLATAILDFEYLICFYFTNGNWTEARDASICMEKDFIIRPIVNCLPAWFRF 441

  Fly   442 AQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYANTFSNPYTWLFLSSCVVATI 506
            ||||||:||| .::..:|:|||||||||:||:|:||:......||:||.||||||::.:.:|::.
  Fly   442 AQCLRRYRDS-REAFPHLVNAGKYSTTFMVVIFATLKSFHSPNYASTFDNPYTWLWIIASIVSSC 505

  Fly   507 YCYLWDVIRDFGLFRIMRGERIFLRKQLVYPQ-AFYYFVIVENLVLRLFWAVEFTILYHNLMTPY 570
            |.|.||:..|:|||....||..|||:::||.. .||||.|:|:|.||..||:.|.:....:::..
  Fly   506 YAYTWDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAILEDLALRFIWALSFYLTEMKIVSSD 570

  Fly   571 NMRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDIHLAALNPRQERMLESMMDESDGVSNR 635
            .|.:::.|||:.|||:||:.|||||||.|||.|||.|||.:|.|:...:.::..:|||:|||.||
  Fly   571 IMTSVTGILEVFRRFVWNFFRLENEHLNNCGKFRAVRDISIAPLDSSDQALILRLMDEADGVINR 635

  Fly   636 -RKSN 639
             .|:|
  Fly   636 YTKAN 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 67/172 (39%)
SPX_XPR1_like 2..158 CDD:269898 64/167 (38%)
EXS 260..597 CDD:281164 159/341 (47%)
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 64/167 (38%)
SPX 3..158 CDD:281146 64/168 (38%)
EXS 258..597 CDD:281164 159/341 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196152152
eggNOG 1 0.900 E1_COG5409
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10783
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.