DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and Xpr1

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001099462.1 Gene:Xpr1 RGDID:1306554 Length:696 Species:Rattus norvegicus

Alignment Length:690 Identity:273/691 (40%)
Similarity:396/691 (57%) Gaps:67/691 (10%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            |||.:...:|:|.|||:||::|...|:::....:.|||...:.:..|:.|:..|||.|...|:.|
  Rat     1 MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKE 65

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQR---------AERSQKKLMTT 121
            |..:|.|:.|||.||:|:...|:.:|.:.......:...::|.||         .||.|.:  ..
  Rat    66 LAKINTFYSEKLAEAQRRFATLQNELQSSLDAQKESTGVTTLRQRRKPVFHLSHEERVQHR--NI 128

  Fly   122 RQLRYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQR 186
            :.|:.|::||||||:|:||||:||.||||||.||:||.:.:.....|.|.:|..|||...:.:.:
  Rat   129 KDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHVEVAPFYICKKINQ 193

  Fly   187 MTIEVEDLYTTHLANGDRSLAMEKLRVPPLG--EPTPPSMVFRAGIALGMLIML---LVATAI-- 244
            :..|.|.:.|..|.:|||..||::|||||||  :|.|....||.|:..|:.|:|   ||..|:  
  Rat   194 LISETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFFGIFIVLNITLVFAAVFK 258

  Fly   245 -----SYWKRAPLEDHTPGLMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRSHLQP 304
                 :.|.          |:|::||.|..:.|.|.:..|..||:||||||:||||::||::|..
  Rat   259 LETDRTVWP----------LIRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSH 313

  Fly   305 ATFLEIACTFGILWALSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPARWWTIKL 369
            ....|||...||||.||:|...:.. |.:...||:||.|...||..|:.|.....:.:|:|.:||
  Rat   314 QHLFEIAGFLGILWCLSLLACFFAP-ISIIPIYVYPLALYGFMVFFLINPTKTFYYKSRFWLLKL 377

  Fly   370 VGRVITAPLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRYDRVNNCFEPDVMVP---- 430
            :.||.|||.|.|||||||:.||:|||...::|..|.:.||:.. |::|........|...|    
  Rat   378 LFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSFE-LKWDESKGLLPNDPQEPEFCH 441

  Fly   431 --------ITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTL-RRNSEGGYA 486
                    |..|:|.|.||.|||||:||: .::..:|:|||||||||..|.|:.| ..:.|.|::
  Rat   442 GYTYGVRAIVQCIPAWLRFIQCLRRYRDT-RRAFPHLVNAGKYSTTFFTVTFAALYSTHKERGHS 505

  Fly   487 NTFSNPYTWLFLSSCVVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYPQ-AFYYFVIVENLV 550
            :|....|.|:..  |::::.|..:||:..|:|||....||..|||:::|||| |:||..|||:::
  Rat   506 DTMVFFYLWVVF--CIISSCYTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYYCAIVEDVI 568

  Fly   551 LRLFWAVEFTILYHNLMTPYN------MRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDI 609
            ||..|.::.:|    ..|.:.      :.|:.:.||:.|||:||:.|||||||.|||.|||.|||
  Rat   569 LRFAWTIQISI----TATTFKPHVGDIIATVFAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDI 629

  Fly   610 HLAALNPRQERMLESMMDESDGVSNRRKS-----NERIRL 644
            .:|.||...:.:||.|||:.|||.||:||     |:.|.|
  Rat   630 SVAPLNADDQTLLEQMMDQEDGVRNRQKSRSWKYNQSISL 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 65/170 (38%)
SPX_XPR1_like 2..158 CDD:269898 63/165 (38%)
EXS 260..597 CDD:281164 145/357 (41%)
Xpr1NP_001099462.1 SPX_XPR1_like 2..165 CDD:269898 63/165 (38%)
SPX 3..169 CDD:281146 63/168 (38%)
EXS 286..617 CDD:281164 139/340 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.