DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and vtc4

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_588142.1 Gene:vtc4 PomBaseID:SPCC1322.14c Length:721 Species:Schizosaccharomyces pombe

Alignment Length:176 Identity:40/177 (23%)
Similarity:69/177 (39%) Gaps:38/177 (21%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            ||||:..:..|..|::..|:.|..||:.||:  .|.....:..|          |..|:...:.|
pombe     1 MKFGQLLKETLMYEYKYSYVNYDKLKKEIKR--RNDQGGWSEED----------ESDFVELLEKE 53

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQRAERSQKKLMTTRQLRYAYAE 130
            |..|.:|...|..|.        ::.:.:..|     ....:.:|.:...    ...:..:|..|
pombe    54 LDKVYSFQKNKSAEV--------MERIRFCEE-----QTDEVVRRLDSDN----PPNENDFAILE 101

  Fly   131 FYLSLVL-----IQNYQSLNETGFRKICKKYDKN----MRSVAAGR 167
            ..|:.::     :..:..||.|.|.||.||:||:    ::.|.|.|
pombe   102 TELTDIMATVHDLAKFSELNYTAFYKIIKKHDKHTGWILKPVFAAR 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 37/170 (22%)
SPX_XPR1_like 2..158 CDD:269898 35/161 (22%)
EXS 260..597 CDD:281164
vtc4NP_588142.1 COG5036 1..504 CDD:227369 40/177 (23%)
SPX_VTC2_like 2..134 CDD:269901 35/161 (22%)
PolyPPase_VTC4_like 188..473 CDD:143623
VTC1 609..721 CDD:227589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.