DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and Xpr1

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_035403.1 Gene:Xpr1 MGIID:97932 Length:695 Species:Mus musculus

Alignment Length:690 Identity:271/691 (39%)
Similarity:396/691 (57%) Gaps:68/691 (10%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            |||.:...:|:|.|||:||::|...|:::....:.|||...:.:..|:.|:..|||.|...|:.|
Mouse     1 MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKE 65

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQR---------AERSQKKLMTT 121
            |..:|.|:.|||.||:|:...|:.:|.:.......:...::|.||         .||.|.:  ..
Mouse    66 LAKINTFYSEKLAEAQRRFATLQNELQSSLDVQKESSGVTTLRQRRKPVFHLSHEERVQHR--NI 128

  Fly   122 RQLRYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQR 186
            :.|:.|::||||||:|:||||:||.||||||.||:||.:.:.....|.|.:|..|||...:.:.:
Mouse   129 KDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVIHVEVAPFYTCKKINQ 193

  Fly   187 MTIEVEDLYTTHLANGDRSLAMEKLRVPPLG--EPTPPSMVFRAGIALGMLIML---LVATAI-- 244
            :..|.|.:.|..|.:|||..||::|||||||  :|.|....||.|:..|:.|:|   ||..|:  
Mouse   194 LISETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVFAAVFK 258

  Fly   245 -----SYWKRAPLEDHTPGLMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRSHLQP 304
                 :.|.          |:|::||.|..:.|.|.:..|..||:||||||:||||::||::|..
Mouse   259 LETDRTVWP----------LIRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSH 313

  Fly   305 ATFLEIACTFGILWALSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPARWWTIKL 369
            ....|||...||||.||:|...:.. |.:...||:||.|...||..|:.|.....:.:|:|.:||
Mouse   314 QHLFEIAGFLGILWCLSLLACFFAP-ISIIPIYVYPLALYGFMVFFLINPTKTFYYKSRFWLLKL 377

  Fly   370 VGRVITAPLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRYDRVNNCFEPDVMVP---- 430
            :.||.|||.|.|||||||:.||:|||...::|..|.:.||:.. |::|........|...|    
Mouse   378 LFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSFE-LKWDESKGLLPNDPQEPEFCH 441

  Fly   431 --------ITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTL-RRNSEGGYA 486
                    |..|:|.|.||.|||||:||: .::..:|:|||||||||..|.|:.| ..:.|..::
Mouse   442 KYSYGVRAIVQCIPAWLRFIQCLRRYRDT-RRAFPHLVNAGKYSTTFFTVTFAALYSTHEEQNHS 505

  Fly   487 NTFSNPYTWLFLSSCVVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYPQ-AFYYFVIVENLV 550
            :|....|.|:|.  |::::.|..:||:..|:|||....||..|||:::|||| |:||..|:|:::
Mouse   506 DTVVFFYLWVFF--CIISSCYTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYYCAIIEDVI 568

  Fly   551 LRLFWAVEFTIL------YHNLMTPYNMRTISSILEITRRFIWNYVRLENEHLFNCGNFRATRDI 609
            ||..|.::.:|.      ..|::.     |:.:.||:.|||:||:.|||||||.|||.|||.|||
Mouse   569 LRFAWTIQISITATFKPHVGNIIA-----TVFAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDI 628

  Fly   610 HLAALNPRQERMLESMMDESDGVSNRRKS-----NERIRL 644
            .:|.||...:.:||.|||:.|||.||:|:     |:.|.|
Mouse   629 SVAPLNADDQTLLEQMMDQEDGVRNRQKNRSWKYNQSISL 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 65/170 (38%)
SPX_XPR1_like 2..158 CDD:269898 63/165 (38%)
EXS 260..597 CDD:281164 144/357 (40%)
Xpr1NP_035403.1 SPX_XPR1_like 2..165 CDD:269898 63/165 (38%)
SPX 3..169 CDD:281146 63/168 (38%)
Important for inositol polyphosphate binding. {ECO:0000250|UniProtKB:P43585} 158..165 5/7 (71%)
EXS 286..616 CDD:281164 138/340 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.910

Return to query results.
Submit another query.