DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2901 and xpr1a

Sequence 1:NP_570077.1 Gene:CG2901 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001232029.1 Gene:xpr1a ZFINID:ZDB-GENE-060503-362 Length:692 Species:Danio rerio

Alignment Length:683 Identity:274/684 (40%)
Similarity:399/684 (58%) Gaps:65/684 (10%)


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            |||.:...:|:|.|||:||::|...||::....:.|||...:.:..|:.||..|||.|...|:.|
Zfish     1 MKFAEHLSAHITPEWRKQYIQYEAFKEMLYAAQDQAPSLEVTDEDTVKRYYAKFEEKFFQTCEKE 65

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQL---LAYSRE---PGHTGSDSSLSQRAERSQKKLMTTRQL 124
            |:.:|.|:.|||.||:|:...|:.:|   |...||   |.......::...:.:.:.|....:.|
Zfish    66 LSKINTFYSEKLAEAQRRFATLQNELQTSLDAQRESNAPALRSRRKTVLPLSNKERNKHRNIKDL 130

  Fly   125 RYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTDVRLLQRMTI 189
            :.|::||||||:|:||||:||.||||||.||:||.:.:.....|.|.:|..|||...:.:.::..
Zfish   131 QLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILDTPRGADWRVAHVEVAPFYTCKKITQLIS 195

  Fly   190 EVEDLYTTHLANGDRSLAMEKLRVPPLG--EPTPPSMVFRAGIALGMLIMLLVATAI--SYWKRA 250
            |.|.|.||.|..|||..||::|||||||  :|.|....||.|:..|:.|:|.||..:  :::.| 
Zfish   196 ETEALVTTELEGGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLYCGVFIVLAVAFVLTGAFFVR- 259

  Fly   251 PLEDHTPGLMRLFRGPFTWVIFNFYMAANVAGWQQAGVNHILIFEIDPRSHLQPATFLEIACTFG 315
              :.:...|:|::||.|..|.|.|.:..|..||:||||||:||||::||::|......|||...|
Zfish   260 --KQNIWPLVRIYRGGFLLVQFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHLFEIAGFLG 322

  Fly   316 ILWALSMLGFLYNDLIGVSDPYVF------PLGLILIMVGLLVVPLPIMNWPARWWTIKLVGRVI 374
            :||.||:|..|:.|       |.:      ||.|...|:..|:.|.....:.:|:|.|||:.||.
Zfish   323 VLWCLSILSCLFAD-------YTWLPMQANPLILYGFMLLFLINPFKTAYYKSRFWLIKLLFRVF 380

  Fly   375 TAPLHYVGFADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRYDRVN------------NCFEPDV 427
            |||.|.|.|||||:.||:||||..:.|..|.|.:|::. |::...|            |.|...|
Zfish   381 TAPFHRVEFADFWLADQLNSLVIVLSDLEYLVCYYSME-LQWGERNGLLPAKFGDERCNSFSYGV 444

  Fly   428 MVPITMCLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTL-RRNSEGGYANTFSN 491
            .. |..|||.|.||.|||||:||: .::..:|:|||||||||.||.|:.| |.:.:..:|:  |.
Zfish   445 RA-IIHCLPAWLRFVQCLRRYRDT-RRAFPHLVNAGKYSTTFFVVTFAALYRTHKDQNHAD--SE 505

  Fly   492 PYTWLFLSSCVVATIYCYLWDVIRDFGLFRIMRGERIFLRKQLVYP-QAFYYFVIVENLVLRLFW 555
            .:.::.:.|.:|:::|..:||:..|:|||....||..|||:::||| :|:||..|:|:::||..|
Zfish   506 VFFYMLVLSSIVSSLYTLIWDLKMDWGLFDRNAGENTFLREEIVYPHKAYYYCAIIEDVLLRFAW 570

  Fly   556 AVEFTILYHNLMTPYNMRTISSI----------LEITRRFIWNYVRLENEHLFNCGNFRATRDIH 610
            .::.::.        :|..|.||          ||:.|||:||:.|||||||.|||.|||.|||.
Zfish   571 TLQISLT--------SMTRIPSIEDIVVTILAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDIS 627

  Fly   611 LAALNPRQERMLESMMDESDGVSNR--RKSNER 641
            :|.||...:.:||.|||:.|||.||  :||.:|
Zfish   628 VAPLNADDQTLLEQMMDQEDGVRNRQGKKSWKR 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 66/167 (40%)
SPX_XPR1_like 2..158 CDD:269898 64/162 (40%)
EXS 260..597 CDD:281164 146/367 (40%)
xpr1aNP_001232029.1 SPX_XPR1_like 2..164 CDD:269898 64/162 (40%)
SPX 3..169 CDD:281146 64/166 (39%)
EXS 284..614 CDD:281164 139/350 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.