DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and MXD3

DIOPT Version :10

Sequence 1:NP_570071.3 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_112590.1 Gene:MXD3 / 83463 HGNCID:14008 Length:206 Species:Homo sapiens


Alignment Length:111 Identity:40/111 - (36%)
Similarity:62/111 - (55%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 SQLSAHHHTGHGGRRRTTSSNSNGA--GTREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKT 492
            :.|..|...|...||:.....:.||  ..|.|||:|||.||||||.|.:.||:.:|:| .|..:.
Human    30 ASLCPHRSPGPIHRRKKRPPQAPGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLG-ADCARY 93

  Fly   493 SNLTILDTAHKYVNSLSHEVCEQEAK--IEKLAKQKIELQKRLKQL 536
            :.|::|..|..::..|..:  ||.|:  .|:|..::..||::|:||
Human    94 TTLSLLRRARMHIQKLEDQ--EQRARQLKERLRSKQQSLQRQLEQL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_570071.3 bHLHzip_Mnt 455..533 CDD:381408 30/79 (38%)
MXD3NP_112590.1 Interaction with SIN3A and SIN3B. /evidence=ECO:0000250 8..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..67 12/36 (33%)
bHLHzip_Mad3 53..137 CDD:381502 33/86 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.