DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and MYC

DIOPT Version :10

Sequence 1:NP_570071.3 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_002458.2 Gene:MYC / 4609 HGNCID:7553 Length:454 Species:Homo sapiens


Alignment Length:164 Identity:38/164 - (23%)
Similarity:64/164 - (39%) Gaps:44/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 AVGMSIASSAPAAGS--------------QLSAHHHT--------------------------GH 440
            |.|....|.:|:||.              .:|.|.|.                          ..
Human   287 APGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQI 351

  Fly   441 GGRRRTTSSNSNGAG---TREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAH 502
            ...|:.||..|:...   .|..||.||::||.:||..:..|:..:| ..|:.:|...:.||..|.
Human   352 SNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIP-ELENNEKAPKVVILKKAT 415

  Fly   503 KYVNSLSHEVCEQEAKIEKLAKQKIELQKRLKQL 536
            .|:.|:..|..:..::.:.|.|::.:|:.:|:||
Human   416 AYILSVQAEEQKLISEEDLLRKRREQLKHKLEQL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_570071.3 bHLHzip_Mnt 455..533 CDD:381408 22/80 (28%)
MYCNP_002458.2 Myc_N 17..360 CDD:460045 11/72 (15%)
9aaTAD. /evidence=ECO:0000269|PubMed:34342803 115..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..310 6/22 (27%)
bHLHzip_c-Myc 366..449 CDD:381464 23/83 (28%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 369..382 5/12 (42%)
UBR5-degron. /evidence=ECO:0000269|PubMed:37478862 370..379 4/8 (50%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 383..421 10/38 (26%)
Leucine-zipper 428..449 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.