DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and Mxd4

DIOPT Version :10

Sequence 1:NP_570071.3 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_034883.2 Gene:Mxd4 / 17122 MGIID:104991 Length:209 Species:Mus musculus


Alignment Length:107 Identity:32/107 - (29%)
Similarity:61/107 - (57%) Gaps:11/107 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 GHGGRRRTTSSN--SNGAGTREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTA 501
            |...|::|.::.  ......|..||:|||.|||:|:...:.||:::|:|.:..:.|: |::|..|
Mouse    35 GDFARKKTKTAGLVRKAPNNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTT-LSLLKRA 98

  Fly   502 HKYVNSLSHEVCEQEAKI----EKLAKQKIELQKRLKQLSLR 539
            ..::..|.    ||:.:.    |:|.::...|::||:|||::
Mouse    99 KMHIKKLE----EQDRRALSIKEQLQREHRFLKRRLEQLSVQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_570071.3 bHLHzip_Mnt 455..533 CDD:381408 24/81 (30%)
Mxd4NP_034883.2 Interaction with SIN3A and SIN3B. /evidence=ECO:0000269|PubMed:8521822 6..23
bHLHzip_Mad4 53..140 CDD:381499 29/89 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..209 32/107 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.