DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and Mxd3

DIOPT Version :10

Sequence 1:NP_570071.3 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_057871.2 Gene:Mxd3 / 17121 MGIID:104987 Length:206 Species:Mus musculus


Alignment Length:111 Identity:42/111 - (37%)
Similarity:64/111 - (57%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 SQLSAHHHTGHGGRRRTTSSNSNGA--GTREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKT 492
            :.|..||..|...|||.....:.||  ..|.|||:|||.||||||.|.:.|::.:|:| .|..:.
Mouse    30 ASLCPHHSPGTVCRRRKPPLQAPGALNSGRSVHNELEKRRRAQLKRCLEQLRQQMPLG-VDCTRY 93

  Fly   493 SNLTILDTAHKYVNSLSHEVCEQEAK--IEKLAKQKIELQKRLKQL 536
            :.|::|..|..::..|..:  ||:|:  .|||..::..||::|:||
Mouse    94 TTLSLLRRARVHIQKLEEQ--EQQARRLKEKLRSKQQSLQQQLEQL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_570071.3 bHLHzip_Mnt 455..533 CDD:381408 30/79 (38%)
Mxd3NP_057871.2 Interaction with SIN3A and SIN3B. /evidence=ECO:0000269|PubMed:8521822 8..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..66 13/35 (37%)
bHLH_SF 53..126 CDD:469605 30/75 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..171 7/16 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.