DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Parg and TEJ

Sequence 1:NP_001245511.1 Gene:Parg FlyBaseID:FBgn0023216 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_565730.1 Gene:TEJ AraportID:AT2G31870 Length:548 Species:Arabidopsis thaliana

Alignment Length:466 Identity:168/467 (36%)
Similarity:232/467 (50%) Gaps:105/467 (22%)


  Fly   150 LLDEELDESETRVFFEDLLPRIIRLALRLPDL--------------IQSPVPLLKHHKNASLSLS 200
            |.||.:||.|::.:|::::|.:..|.|:.|.|              |::.:.||...:...:.||
plant    78 LFDELIDEKESKRWFDEIIPALASLLLQFPSLLEVHFQNADNIVSGIKTGLRLLNSQQAGIVFLS 142

  Fly   201 QQQISCLLANAFLCTFPRRNTLKRKSEYSTFPDINFNR----LYQSTGPAVLEKLKCIMHYFRRV 261
            |:.|..|||.:|.|.||..|   |.:::  .|.|||:.    ||.|...:...|::||||||.|.
plant   143 QELIGALLACSFFCLFPDDN---RGAKH--LPVINFDHLFASLYISYSQSQESKIRCIMHYFERF 202

  Fly   262 CPTERDASNVPTGVVTFVRRSGLPEHLIDWSQSAAPLGDVPLHVDAEGTIEDEGIGLLQVDFANK 326
            |      |.||.|:|:|.|:.........||:|...|....:|  :.|.|||:....|:||||||
plant   203 C------SCVPIGIVSFERKITAAPDADFWSKSDVSLCAFKVH--SFGLIEDQPDNALEVDFANK 259

  Fly   327 YLGGGVLGHGCVQEEIRFVICPELLVGKLFTECLRPFEALVMLGAERYSNYTGYAGSFEWSGNFE 391
            |||||.|..|||||||||:|.|||:.|.||...:...||:.::||||:|.|||||.||.::|.:.
plant   260 YLGGGSLSRGCVQEEIRFMINPELIAGMLFLPRMDDNEAIEIVGAERFSCYTGYASSFRFAGEYI 324

  Fly   392 DSTPRDSSGRRQTAIVAIDALHFAQSHHQYREDLMERELNKAYIGFVH----W------------ 440
            |....|...||:|.|||||||...:..| :::..:.||:|||..||::    |            
plant   325 DKKAMDPFKRRRTRIVAIDALCTPKMRH-FKDICLLREINKALCGFLNCSKAWEHQNIFMDEGDN 388

  Fly   441 ---MV------------------TP------------------------------PPGVATGNWG 454
               :|                  ||                              ..||||||||
plant   389 EIQLVRNGRDSGLLRTETTASHRTPLNDVEMNREKPANNLIRDFYVEGVDNEDHEDDGVATGNWG 453

  Fly   455 CGAFGGDSYLKALLQLMVCAQLGRP-LAYYTFGNVEFRD-DFHEMWLLFRNDGTTVQQLWSILRS 517
            ||.||||..|||.:|.:..:|..|| ::|||||....|: |....|:|  :...||..||:::..
plant   454 CGVFGGDPELKATIQWLAASQTRRPFISYYTFGVEALRNLDQVTKWIL--SHKWTVGDLWNMMLE 516

  Fly   518 YS--RLIKEKS 526
            ||  ||.|:.|
plant   517 YSAQRLYKQTS 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PargNP_001245511.1 PARG_cat 155..492 CDD:282834 152/423 (36%)
TEJNP_565730.1 PARG_cat 83..492 CDD:282834 152/423 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D730627at2759
OrthoInspector 1 1.000 T124833
orthoMCL 1 0.900 OOG5_128766
Panther 1 1.100 LDO PTHR12837
Phylome 1 0.910 0.870 Consistency score
65.920

Return to query results.
Submit another query.