DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Parg and PARG2

Sequence 1:NP_001245511.1 Gene:Parg FlyBaseID:FBgn0023216 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_973578.1 Gene:PARG2 AraportID:AT2G31865 Length:532 Species:Arabidopsis thaliana

Alignment Length:452 Identity:146/453 (32%)
Similarity:219/453 (48%) Gaps:107/453 (24%)


  Fly   152 DEELDESETRVFFEDLLPRIIRLALRLPDLIQSPVPLLKHHKNAS-------------------- 196
            |:::...|:..||.:::|.:.||.|:||.:::      ||::.|.                    
plant    82 DKKISREESANFFGEVVPALCRLLLQLPSMLE------KHYQKADHVLDGVKSGLRLLGPQEAGI 140

  Fly   197 LSLSQQQISCLLANAFLCTFPR-RNTLKRKSEYSTFPDINFNRL----YQSTGPAVLEKLKCIMH 256
            :.|||:.|:.|||.:|.|.||. ..:||      ....|||:.|    |.........|:||::|
plant   141 VLLSQELIAALLACSFFCLFPEVDRSLK------NLQGINFSGLFSFPYMRHCTKQENKIKCLIH 199

  Fly   257 YFRRVCPTERDASNVPTGVVTFVRRSGLP----EHLI------DWSQSAAPLGDVPLHVDAEGTI 311
            ||.|:|..      :|||.|:|.|:. ||    .|.:      .|:.|..||..:.:|  ..|.|
plant   200 YFGRICRW------MPTGFVSFERKI-LPLEYHPHFVSYPKADSWANSVTPLCSIEIH--TSGAI 255

  Fly   312 EDEGIGLLQVDFANKYLGGGVLGHGCVQEEIRFVICPELLVGKLFTECLRPFEALVMLGAERYSN 376
            ||:....|:||||::|.||..|.:..:||||||||.|||:.|.:|...:...||:.::|.||:|.
plant   256 EDQPCEALEVDFADEYFGGLTLSYDTLQEEIRFVINPELIAGMIFLPRMDANEAIEIVGVERFSG 320

  Fly   377 YTGYAGSFEWSGNFEDSTPRDSSGRRQTAIVAIDALHFAQSHHQYREDLMERELNKAYIGFVH-- 439
            ||||..||:::|::.|:...|...||:|.::||||:. .....||:.|.:.||:|||:.|::|  
plant   321 YTGYGPSFQYAGDYTDNKDLDIFRRRKTRVIAIDAMP-DPGMGQYKLDALIREVNKAFSGYMHQC 384

  Fly   440 -------------------------------------------WMVTPPP---GVATGNWGCGAF 458
                                                       |.:....   ||||||||||.|
plant   385 KYNIDVKHDPEASSSTKIKFVFAKQHVPLTSDSASQVIESSHRWCIDHEEKKIGVATGNWGCGVF 449

  Fly   459 GGDSYLKALLQLMVCAQLGRP-LAYYTFGNVEFRDDFHEMWLLFRNDGTTVQQLWSILRSYS 519
            |||..||.:||.:..:|.||| ::||||| ::...:.:::..:......||..||..|..||
plant   450 GGDPELKIMLQWLAISQSGRPFMSYYTFG-LQALQNLNQVIEMVALQEMTVGDLWKKLVEYS 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PargNP_001245511.1 PARG_cat 155..492 CDD:282834 138/421 (33%)
PARG2NP_973578.1 PARG_cat 85..484 CDD:282834 138/422 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D730627at2759
OrthoInspector 1 1.000 T124833
orthoMCL 1 0.900 OOG5_128766
Panther 1 1.100 O PTHR12837
Phylome 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.