DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2875 and NOC4

Sequence 1:NP_570069.1 Gene:CG2875 FlyBaseID:FBgn0029672 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_015470.1 Gene:NOC4 SGDID:S000006348 Length:552 Species:Saccharomyces cerevisiae

Alignment Length:522 Identity:143/523 (27%)
Similarity:252/523 (48%) Gaps:86/523 (16%)


  Fly    35 DIKTLKGFVQLLKN--TPDNMPAGE-----------VMNTLEVIFKNLLKR--KAIDGTEKQGLK 84
            |.|.....::|:..  .|:|:...|           ||:..: ||:.|..|  ..:..::|..|:
Yeast    20 DRKQYNSIIKLINELVIPENVTQLEEDETEKNLRFLVMSLFQ-IFRKLFSRGDLTLPSSKKSTLE 83

  Fly    85 -------IKKLYE--ETWLL-LIENLLVDSQCSV-AVKVCMQLIKVEAKH-------PIAPNKGW 131
                   .:|:||  :|.|| :|.::..::...: ::.|.:||.::|:.|       |..|||.:
Yeast    84 KEQFVNWCRKVYEAFKTKLLAIISDIPFETSLGLDSLDVYLQLAELESTHFASEKGAPFFPNKTF 148

  Fly   132 P----TYWIRGM--LETLINSDTTPTTALANYGK--YCKNLDVLEITLTQLKSLVPDEDFKDSPI 188
            .    ..|...|  :|.:.:|..:....:..:.:  |.|..|:.....::...|:.|..::|..:
Yeast   149 RKLIIALWSSNMGEIEDVKSSGASENLIIVEFTEKYYTKFADIQYYFQSEFNQLLEDPAYQDLLL 213

  Fly   189 KAM-NFLSIVNLLDMGKSVLSTADYH---------VESAKKQTFNYELNRKRLNNLWATIMAKGN 243
            |.: .:|::||......||  .||..         :|:..|...|:|.|       |.:::  ..
Yeast   214 KNVGKWLALVNHDKHCSSV--DADLEIFVPNPPQAIENESKFKSNFEKN-------WLSLL--NG 267

  Fly   244 EVDEKLHRQILVVLLERVINHLNDPIQLTDFLMDSL-----HQFDGPIALLALQGIFTLMQKQNI 303
            ::..:.::.||::|.:|:|.|.:.|.:|.|||.||.     ::..|.:.:|||.|:|.||::.|:
Yeast   268 QLSLQQYKSILLILHKRIIPHFHTPTKLMDFLTDSYNLQSSNKNAGVVPILALNGLFELMKRFNL 332

  Fly   304 TYPDVYEKLYNMFYPRMFHNKYKARLFYLADIFLTSTHLPENLVAAFVKRLARLALQSPTEDAVI 368
            .||:.|.|||.:..|.:.|.||:||.|.|.|:||:||||..:|||:|:|:||||.|:||....|.
Yeast   333 EYPNFYMKLYQIINPDLMHVKYRARFFRLMDVFLSSTHLSAHLVASFIKKLARLTLESPPSAIVT 397

  Fly   369 MIRFVCNLLLRHTGLQKLIRASHAV-------DEVS----------DPYNQTETDPVKSEAINSS 416
            :|.|:.||:.:|.....::.....:       |:|:          ||::..|:||..:.|::||
Yeast   398 VIPFIYNLIRKHPNCMIMLHNPAFISNPFQTPDQVANLKTLKENYVDPFDVHESDPELTHALDSS 462

  Fly   417 LWEITLLQKHVVPEVANAARFINSSLPVMEFDLAPLLDRKECNIFDDELQSKAKQF-ALNYERPT 480
            |||:..|.:|..|.||..|:........:.:::...||....::.:.|...|.|.. .|.:|..|
Yeast   463 LWELASLMEHYHPNVATLAKIFAQPFKKLSYNMEDFLDWNYDSLLNAESSRKLKTLPTLEFEAFT 527

  Fly   481 NL 482
            |:
Yeast   528 NV 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2875NP_570069.1 CBF 287..435 CDD:281851 65/165 (39%)
NOC4NP_015470.1 CBF 317..481 CDD:281851 65/164 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214366689
eggNOG 1 0.900 E1_KOG2154
Hieranoid 1 1.000
Homologene 1 1.000 H40545
Inparanoid 1 1.050 169 1.000 Inparanoid score I1006
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004223
OrthoInspector 1 1.000 T1136952
orthoMCL 1 0.900 OOG5_128560
Panther 1 1.100 LDO PTHR12455
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1838
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.