DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2875 and EMB2762

Sequence 1:NP_570069.1 Gene:CG2875 FlyBaseID:FBgn0029672 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_179316.2 Gene:EMB2762 AraportID:AT2G17250 Length:577 Species:Arabidopsis thaliana

Alignment Length:542 Identity:128/543 (24%)
Similarity:223/543 (41%) Gaps:116/543 (21%)


  Fly    22 QSKANSLLNAEQVDIKTLKGFVQLLKNTP--DNMPAGEVMNTLEVIFKNLLKRKAIDGTEKQGLK 84
            |....|||:.:..       |..||...|  .:.|:.......||:||..|:.|           
plant    51 QFVVESLLSLQSF-------FTPLLSQLPPTSSSPSSTKTEDPEVVFKAWLRSK----------- 97

  Fly    85 IKKLYEETWLLLIENLL----VDSQCSVAVKVCMQLIKVEAKHPIAPNKG-WPTYWIRGMLETLI 144
                ::|...||::.|:    .||...:.:...|:.:|:       .|.| :.:.....:|:.:|
plant    98 ----FDEFVKLLLDVLVSQQSEDSLRGIVLGTLMEFVKL-------LNAGRFHSSIYHRLLDAII 151

  Fly   145 NSDTTPTTAL-ANYGKYCKNLDVLEITLTQLKSLV------------------PDEDFKDS-PIK 189
            :|:......| ....||.|.:||...|...::..|                  .:.|.|:| .:.
plant   152 HSEVDIEIFLDILTSKYFKYIDVRYFTYISMEKFVKTLEASVSADRTVIENNEAESDSKESLELS 216

  Fly   190 AMNFLSIVNLLDMGKSVLSTADYHVESAKKQTFNYELNRK-----------------------RL 231
            ......:::.:...:.....:.:.:.|...::.:.:...|                       :.
plant   217 VRKIYQVLSQIPPPEKQAEKSQHEMWSGSDESISEKPTDKKKKTEKGDSTLLSPATISKRMKLKF 281

  Fly   232 NNLWATIMAKGNEVDEKLHRQILVVLLERVINHLNDPIQLTDFLMDSLHQFDGPIALLALQGIFT 296
            ...|.:.:.....:|  :::::|..:...||.||::|..|.|||..| :...|.::::||..:|.
plant   282 TKAWISFLRLPLPID--VYKEVLASIHLTVIPHLSNPTMLCDFLTKS-YDIGGVVSVMALSSLFI 343

  Fly   297 LMQKQNITYPDVYEKLYNMFYPRMFHNKYKARLFYLADIFLTSTHLPENLVAAFVKRLARLALQS 361
            ||.:..:.||..|||||.:..|.:|..|::|:...|.|..|.|:.||..|.|:|.|:|:||:|..
plant   344 LMTQHGLEYPFFYEKLYALLVPSVFVAKHRAKFLQLLDACLKSSMLPAYLAASFTKKLSRLSLSI 408

  Fly   362 PTEDAVIMIRFVCNLLLRHTGLQKLIR-----ASHAVDEVS-----------------DPYNQTE 404
            |...::::...:.|||.|:..:..|::     |..|..|..                 |.:|..|
plant   409 PPAGSLVITALIYNLLRRNPTINHLVQEIVENADEANTEAGEHNESQPKTIKKRKLGIDYFNNQE 473

  Fly   405 TDPVKSEAINSSLWEITLLQKHVVPEVANAARFINS---SLPV----MEFDLAPLLDRKECNIFD 462
            :||.||.|:.||||||..|:.|..|.|   :|||:|   :|.:    .|..:..........||.
plant   474 SDPKKSGALKSSLWEIDTLRHHYCPPV---SRFISSLETNLTIRSKTTEMKIEDFCSGSYATIFG 535

  Fly   463 DELQSKAKQFALNYER--PTNL 482
            ||::.:.||..|.:.:  ||:|
plant   536 DEIRRRVKQVPLAFYKTVPTSL 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2875NP_570069.1 CBF 287..435 CDD:281851 57/170 (34%)
EMB2762NP_179316.2 CBF 334..503 CDD:281851 58/172 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H40545
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D891751at2759
OrthoInspector 1 1.000 T192925
orthoMCL 1 0.900 OOG5_128560
Panther 1 1.100 LDO PTHR12455
Phylome 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.