DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2875 and NOC4L

Sequence 1:NP_570069.1 Gene:CG2875 FlyBaseID:FBgn0029672 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_076983.1 Gene:NOC4L HGNCID:28461 Length:516 Species:Homo sapiens

Alignment Length:377 Identity:117/378 (31%)
Similarity:212/378 (56%) Gaps:17/378 (4%)


  Fly   108 VAVKVCMQLIKVEAKHPIAPNKGW------PTYWIRGMLETLINSDTTPTTALANYGKYCKNLDV 166
            :|:...::.:::|..||:..:| |      |....:.::..|::.:...:..|:.:.:|....|.
Human   117 LALSALLKFVQLEGAHPLEKSK-WEGNYLFPRELFKLVVGGLLSPEEDQSLLLSQFREYLDYDDT 180

  Fly   167 LEITL---TQLKSLVPDEDFKDSPIKAMNFLSIVNLLDMGKSVLSTADYHVESAKK----QTFNY 224
            ...|:   ....:.|..:..:..|....|..::::.:.:.:...:.:.::|:.|:.    :..:.
Human   181 RYHTMQAAVDAVARVTGQHPEVPPAFWNNAFTLLSAVSLPRREPTVSSFYVKRAELWDTWKVAHL 245

  Fly   225 ELNRKRLNNLWATIMAKGNEVDEKLHRQILVVLLERVINHLNDPIQLTDFLMDSLHQFDGPIALL 289
            :.:|:....:|.:.:.  :::...|::::|:::.:.::..|..|..:.|||..:. ...|.::||
Human   246 KEHRRVFQAMWLSFLK--HKLPLSLYKKVLLIVHDAILPQLAQPTLMIDFLTRAC-DLGGALSLL 307

  Fly   290 ALQGIFTLMQKQNITYPDVYEKLYNMFYPRMFHNKYKARLFYLADIFLTSTHLPENLVAAFVKRL 354
            ||.|:|.|:.|.|:.|||.|.|||.:..|.:||.||:||.|:|||:||:|:|||..|||||.|||
Human   308 ALNGLFILIHKHNLEYPDFYRKLYGLLDPSVFHVKYRARFFHLADLFLSSSHLPAYLVAAFAKRL 372

  Fly   355 ARLALQSPTEDAVIMIRFVCNLLLRHTGLQKLIRASHAVDEVSDPYNQTETDPVKSEAINSSLWE 419
            |||||.:|.|..::::.|:||||.||...:.|:...|..:..:|||:..|.||.:|.|:.|||||
Human   373 ARLALTAPPEALLMVLPFICNLLRRHPACRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWE 437

  Fly   420 ITLLQKHVVPEVANAARFINSSLPVMEFDLAPLLDRKECNIFDDELQSKAKQ 471
            :..||:|..|||:.||..||.:|.:.|..:||||:.....||:.:|:.|..:
Human   438 LQALQRHYHPEVSKAASVINQALSMPEVSIAPLLELTAYEIFERDLKKKGPE 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2875NP_570069.1 CBF 287..435 CDD:281851 77/148 (52%)
NOC4LNP_076983.1 CBF 310..453 CDD:281851 73/143 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214361150
eggNOG 1 0.900 E1_KOG2154
Hieranoid 1 1.000
Homologene 1 1.000 H40545
Inparanoid 1 1.050 205 1.000 Inparanoid score I3682
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D251577at33208
OrthoFinder 1 1.000 FOG0004223
OrthoInspector 1 1.000 T1075526
orthoMCL 1 0.900 OOG5_128560
Panther 1 1.100 LDO PTHR12455
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1838
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.