DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2875 and noc4l

Sequence 1:NP_570069.1 Gene:CG2875 FlyBaseID:FBgn0029672 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001019568.1 Gene:noc4l ZFINID:ZDB-GENE-050522-98 Length:525 Species:Danio rerio

Alignment Length:503 Identity:145/504 (29%)
Similarity:254/504 (50%) Gaps:49/504 (10%)


  Fly    18 KKKLQSKANSLLNAEQ--VDIKTLKGFVQLLKNTPDNMPAGEVM---NTLEVIFKNLLKRKAI-- 75
            ||.:.:|.:.:|..::  .||..:..::|..|..       |::   |....||..|::|..:  
Zfish    19 KKAINTKTDLILQNKKHANDIFDVIEYLQSEKEK-------EIIFATNACSKIFCELIERGDLFV 76

  Fly    76 --------------DGTEKQGLKIKKLYEETWLLLIENLLVDSQCSVAVKVC--MQLIKVEAKHP 124
                          ...||..:.::..|.....|::||:..:|.......:|  |:.:..|.|||
Zfish    77 GELPKEEDLAQGDRSAEEKYHIFMRHRYNSCVELMLENVSHESFQVKETSLCAVMKFVATEGKHP 141

  Fly   125 IAPNKGW------PTYWIRGMLETLINSDTTPTTALANYGKYCKNLDVLEITLTQLK---SLVPD 180
            : .|..|      |...|:.::|.|::.....:..::.:.::.:..||....::.::   :.|.:
Zfish   142 L-QNLDWSEHYNFPRELIQALVEHLLSEKEDMSLLISRFQEFMEKDDVRYYVMSSVRYSTATVME 205

  Fly   181 EDFKD-SPIKAMNFLSIVNLLDMGKSVLSTADYHVESAKK----QTFNYELNRKRLNNLWATIMA 240
            .:.|. .|:...|..:::..:::........::.|:...|    :....:.:::....:|...:.
Zfish   206 RNKKAVIPVFQNNVFNLLTTINIPNQASEMTNFLVQQQSKHDDWKAAKLKEHKRAFEQMWLLFLR 270

  Fly   241 KGNEVDEKLHRQILVVLLERVINHLNDPIQLTDFLMDSLHQFDGPIALLALQGIFTLMQKQNITY 305
              .::...::::|||:|.|.::..::||..:.||| .:.:...|.|:|.||.|:|..:.:.|:.|
Zfish   271 --YKLPGSMYKKILVILHESILPQMSDPKLMMDFL-SAAYDIGGAISLSALNGLFVPIHEHNLDY 332

  Fly   306 PDVYEKLYNMFYPRMFHNKYKARLFYLADIFLTSTHLPENLVAAFVKRLARLALQSPTEDAVIMI 370
            ||.|:||||:..|.:||.||:||.|:||:|||:|||||..||||||||||||:|.:|....:|::
Zfish   333 PDFYKKLYNLLDPSIFHVKYRARFFHLANIFLSSTHLPVYLVAAFVKRLARLSLTAPPTALLILL 397

  Fly   371 RFVCNLLLRHTGLQKLIRASHAVDE-VSDPYNQTETDPVKSEAINSSLWEITLLQKHVVPEVANA 434
            .|:|||:.||...:.||....|.|| ..|||...|.||.:..|:.||||||..||.|..|:|:.|
Zfish   398 PFICNLIRRHPSCRVLIHRPSAADEPCDDPYVMEEEDPAQCHALESSLWEIKTLQNHHHPDVSKA 462

  Fly   435 ARFINSSLPVMEFDLAPLLDRKECNIFDDELQSKAKQFALNYERPTNL 482
            |..||..|...|.|::.||:.....:.:.||:.:.|...|.::..|:|
Zfish   463 ATMINEPLSAQEEDISELLELTTFELMERELKGEKKTVPLEFDMATDL 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2875NP_570069.1 CBF 287..435 CDD:281851 77/149 (52%)
noc4lNP_001019568.1 CBF 314..463 CDD:281851 77/149 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214356084
eggNOG 1 0.900 E1_KOG2154
Hieranoid 1 1.000
Homologene 1 1.000 H40545
Inparanoid 1 1.050 213 1.000 Inparanoid score I3545
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D251577at33208
OrthoFinder 1 1.000 FOG0004223
OrthoInspector 1 1.000 T1054758
orthoMCL 1 0.900 OOG5_128560
Panther 1 1.100 LDO PTHR12455
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.