DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2875 and Noc4l

Sequence 1:NP_570069.1 Gene:CG2875 FlyBaseID:FBgn0029672 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001014151.1 Gene:Noc4l RGDID:1310661 Length:516 Species:Rattus norvegicus

Alignment Length:502 Identity:145/503 (29%)
Similarity:249/503 (50%) Gaps:58/503 (12%)


  Fly     2 KPLTVKVNDDTGKSL-AKKKLQSKANSLLNAEQVDIKTLKGFVQLLKNTPDNMPAGEVMNTLEVI 65
            :|.:.....:.|:.| |....:.:||::.:...|          |....|:.:..|  :.|...:
  Rat     4 QPASTGSRQELGRLLEAVLSNRGRANAVFDILAV----------LQSEDPEEIKEG--VRTCSRL 56

  Fly    66 FKNLLKRK------------AIDGTEKQGLKIKKLYEETWLL--------LIENLLVDSQCSV-- 108
            |..||:|:            |:.|::....|.|     .|:.        .:|.||......|  
  Rat    57 FGTLLEREELFVGSLPCEDMALAGSQGATYKYK-----VWMRHRYHSCCNRLEELLTHPSFQVKE 116

  Fly   109 -AVKVCMQLIKVEAKHPIAPNKGWPTYWI--RGMLETLINSDTTP----TTALANYGKYCKNLDV 166
             |::..|:.:::|...|:...: |.::::  |.:...::....||    :..::.:.:|.:..|:
  Rat   117 LALETLMKFVQLEGAKPLEKPQ-WESHYLFPRTLFRAVVGGLLTPEDDHSLLISQFCEYLEYDDI 180

  Fly   167 LEITLTQLKSLVPDEDFKDSPI------KAMNFLSIVNLLDMGKSVLSTADYHVE-SAKKQTFNY 224
            ....:....|::.....:...:      .|...||.|||......:.:....|.: |:|.:..:.
  Rat   181 RYHAMQVATSILARATSRQPEVSLTFWNNAFTLLSAVNLPLQEHELTNFYVKHAQTSSKWKVVHL 245

  Fly   225 ELNRKRLNNLWATIMAKGNEVDEKLHRQILVVLLERVINHLNDPIQLTDFLMDSLHQFDGPIALL 289
            :..||....:|...:.  :::...|::::||.:.:.::.||..|..:.||| .|.....|.|:||
  Rat   246 KEQRKAFQEMWLGFLK--HKLPLSLYKKVLVAMHDSILPHLAQPTLMIDFL-TSACDVGGAISLL 307

  Fly   290 ALQGIFTLMQKQNITYPDVYEKLYNMFYPRMFHNKYKARLFYLADIFLTSTHLPENLVAAFVKRL 354
            ||.|:|.|:.|.|:.|||.|::||.:..|.:||.||:||.|:|||:||:|:|||..|||||.|||
  Rat   308 ALNGLFILIHKHNLEYPDFYQRLYGLLDPSIFHVKYRARFFHLADLFLSSSHLPAYLVAAFAKRL 372

  Fly   355 ARLALQSPTEDAVIMIRFVCNLLLRHTGLQKLIRASHAVDEVSDPYNQTETDPVKSEAINSSLWE 419
            |||||.:|.|..::::..:||||.||...:.::......:..:|||:.||.||.:|.|:.|.|||
  Rat   373 ARLALTAPPEALLMVLPLICNLLRRHPACRVMVHRPQGPELDADPYDPTEKDPARSRALESCLWE 437

  Fly   420 ITLLQKHVVPEVANAARFINSSLPVMEFDLAPLLDRKECNIFDDELQ 466
            :..||:|..|||:.||..||.:|.|.|..:||||:.....||:.:|:
  Rat   438 LQTLQQHYHPEVSRAASVINQALSVPEVSIAPLLELTAYEIFEQDLK 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2875NP_570069.1 CBF 287..435 CDD:281851 73/148 (49%)
Noc4lNP_001014151.1 NOC3 <96..453 CDD:227447 112/361 (31%)
CBF 305..453 CDD:281851 73/148 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214361565
eggNOG 1 0.900 E1_KOG2154
Hieranoid 1 1.000
Homologene 1 1.000 H40545
Inparanoid 1 1.050 207 1.000 Inparanoid score I3571
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D251577at33208
OrthoFinder 1 1.000 FOG0004223
OrthoInspector 1 1.000 T1089176
orthoMCL 1 0.900 OOG5_128560
Panther 1 1.100 LDO PTHR12455
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.